KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM458540Help
Entry
Phum_PHUM458540   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Phum_PHUM458540
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Phum_PHUM458540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 517 aa AA seqDB search
MGIPVVTLDSYIPKQRLVHFDLKGAPPKVSYIKKVIKLSKQLGATGILMEYEDMFPFWGP
LSVLSAGNAYTKSDIEEILAFAKTNDLDVIPLVQTFGHVEFALKLKNFADLRELILQNIS
NLIYLELNYLKLEFFYFIKSNITFSVMKYHPSAKYLHIGCDEVFQMGECPKCRLQPRYNL
FLSHVSRVANYVRKNYPNVTPIIWDDMLRHLPTQSLEEFHIGKLVEPMVWVYAEDIYRFV
PSLVWEKYAEIFPRVWVASAFKGAFGETMYIPNAKRHLENNLRWLEVMTAENQKFKNGFA
GIALTGWQRYDHFAVLCELLPAGIPSLAINLLAVSHGYFNQSLRNNLLLPLSCQTDSHPY
SGIVNFNSDPFMWSKLSRCFFPGSSFYRLLNRFHSTEKEVKEFLHVTTKSKGWMTDYNTV
HNFSSPLRVDELMVDYPRIYNNLISLERHARESLEEIFDQYTVNEWLEQRIYPYLKKLEQ
LEANALSLKAIKYWPVRPLKSVRSYDEQSNSPGSVKH
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgggaattcctgttgttacattagattcttacattccgaagcaaagattagtacatttt
gatttaaaaggagcccctccaaaagtgagttatattaagaaggtaattaagctttctaag
caattgggagccacaggaatacttatggaatatgaagatatgtttccattttgggggccg
ttatcagttctttctgccggtaatgcatatacaaaaagtgatatagaggaaattcttgct
tttgccaaaactaacgacttggatgtaatacctcttgttcaaacttttggtcacgtggaa
tttgctttaaaattaaaaaattttgctgatttgcgggaacttattttgcaaaatatctct
aatctaatttatttagagttgaattatcttaagttagagtttttttatttcattaaatct
aatattactttttcagtaatgaaatatcatccatctgccaagtatcttcacatcggatgc
gatgaagtttttcaaatgggtgaatgtcctaaatgccgtttgcaaccgaggtataatctt
tttttatcacacgtttctcgcgttgctaattatgtaagaaaaaattatccgaacgtgaca
cccatcatctgggatgatatgcttagacatttgcccactcaatctcttgaagaatttcat
attggaaaattagtggaaccaatggtttgggtgtacgcagaagatatttacagatttgta
ccatctttggtatgggaaaaatacgctgaaatttttccaagggtttgggttgcttctgct
tttaaaggcgcgttcggtgaaacaatgtatattcctaatgccaagagacatttggaaaac
aatttgagatggcttgaagtaatgacggctgaaaatcaaaagtttaaaaatggatttgct
ggcatcgcactcaccggttggcaaagatatgatcatttcgccgttttatgcgaacttctt
cccgccggcattccttcgttggccatcaatcttctagccgtgagtcacggttattttaat
cagtctcttcgtaataatctactgttgcctctcagctgtcaaacggattctcatccgtat
tctggaatagtaaatttcaatagtgatccgtttatgtggagcaagctttctcgatgtttt
tttcctggctctagtttttataggctattgaacaggtttcattctactgaaaaagaagtc
aaagaatttttacatgtcacaacgaaatcaaaaggttggatgacggattacaacacggta
cataatttttccagtccgctgagagtggacgaacttatggtcgattatcctcgtatatat
aataatcttatttcgctcgagcgtcacgccagagagtctttagaagaaattttcgatcaa
tacacagttaatgagtggttagagcaaagaatttacccttatctaaaaaaattagaacaa
ctcgaagccaatgctcttagtcttaaggcaattaaatattggcctgtgaggcctttaaaa
tcagttagaagttacgatgaacaatcaaattcacctggatctgtgaaacattag

DBGET integrated database retrieval system