KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM463810Help
Entry
Phum_PHUM463810   CDS       T01223                                 

Definition
mitogen-activated protein kinase ERK-A, putative (EC:2.7.12.1)
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Phum_PHUM463810
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Phum_PHUM463810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 612 aa AA seqDB search
MDVFLLSPGSIHNKEVLTKYNNGTNAANGKINQVNSNKQLAIRNWSTAMPGKNLENSWGS
KRSLNYSNPKLLVFGNTTQMKSSSKQNIYHSQHNQQENSSSRSSSTAAPSPCFPSINNNN
SSSHNNYHNNNNNVENNPPSQRTDPNGRRLPLTPSEALKYYGSRLTEYEKSEIEKYSEIW
YLGLDACKIHGEDFDDDYGSYHKVLHDHISYRYEILEVIGKGSFGQVIRALDHKTNQHVA
IKIIRNKKRFHHQALIEVKILDHLRKRDKYSLHNVIHMLEYFYFRNHLCISFELMSLNLY
ELIKKNSYQGFSLTLIRRFAHSLVQCLRLLHKENIIHCDLKPENVLLKQRGSSSIKVIDF
GSSCYSHQRVYTYIQSRFYRSPEVILGLPYGTAIDMWSLGCILAELYTGYPLFPGENEIE
QLACVMEILGIPPEDVISNASRKRLFFDSRGNPRCITNSKGRKRKPGSKELASAIRCNDK
QFVDFISQCLQWDAKKRLNPEDALRHDWLKSSSTSSVTQTSQDLRRSPSETGNLGQRRTA
LKSSVTESQYTAFKVHKARKWKYGESENSEQNDVGGTTTVKVNVTTPSVRHTSAGDGETS
LDDFGTFLPPIL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcttcttgttaagtcctggttcaattcataataaagaagttttaacgaaatat
aacaacggaacaaatgcagccaatggaaaaattaatcaggtcaattcgaataagcaatta
gctataagaaattggtcgacagcgatgccagggaaaaatttagaaaattcttggggatct
aaaagaagtttaaattattcgaatccgaaacttcttgtgtttggtaatacgacgcaaatg
aaaagttcatcgaaacaaaatatttatcattcgcaacacaatcaacaagaaaattcatcg
tcgcgatcttcatcgactgcagcaccatcgccgtgttttccgagtataaataataataat
tcttcttctcataataattaccataataataataataacgtggaaaataatcctccgagt
cagagaacggatccaaatggtagacgacttccacttactccttcagaggctctcaaatat
tacggaagtcgattgacggagtatgaaaaaagcgaaatagaaaaatattcagaaatatgg
tatctcggattggatgcctgtaaaatccacggggaagattttgatgatgattacggaagt
taccataaggtgctccacgaccacatttcataccgttatgaaatactcgaggtcatagga
aagggtagcttcggacaagtgataagagctctcgatcataagactaatcaacatgtagcc
ataaagataataagaaataaaaaaagatttcatcatcaagcattgatcgaagttaaaatt
ctcgatcaccttcgtaaaagagacaaatattctcttcataacgtgattcacatgttggaa
tatttttattttaggaatcacctttgtattagttttgaattaatgagccttaatttatac
gagctcataaagaaaaacagttaccaaggatttagtctaacattgatcaggagatttgct
cattcacttgttcagtgtttgcgtcttttacataaagaaaatattattcactgtgatctc
aaacccgaaaacgttttattgaaacaaagaggtagcagttcgataaaagttatagatttc
ggaagttcctgttattctcatcaaagagtttacacatacattcaatctaggttttatcgt
tcgccggaagttattttgggacttccttatggcacggcaatagatatgtggagtttagga
tgcattcttgccgaattatacacgggctacccacttttcccaggggaaaatgaaatagaa
caattagcctgcgttatggaaatattgggaattccacccgaggacgtaataagtaatgca
tcgagaaaaagattatttttcgattcaagaggtaatcctagatgcattaccaatagcaaa
ggaagaaaacgaaaaccgggatcgaaagaacttgcgagtgctattcgttgcaatgataaa
caatttgtagatttcatcagtcaatgtctgcagtgggacgcgaaaaaaagactgaacccc
gaagatgcactcaggcatgattggctaaaatcctcaagcacttcctcggtaactcaaacc
tctcaggaccttcgtagatctccatcagagactggaaatttaggacagcgaagaacagcc
ttaaaatcatccgtaaccgaatctcaatacacagcatttaaagtacataaagcgagaaaa
tggaaatatggggaaagtgaaaattccgaacaaaacgatgtcggaggaacgacaaccgtc
aaagtaaatgtaacgactccttctgttaggcatacgtccgccggtgatggcgaaactagt
ttagatgattttggaacatttttgcccccaatattgtga

DBGET integrated database retrieval system