KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM466000Help
Entry
Phum_PHUM466000   CDS       T01223                                 

Definition
glycerol kinase, putative (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Phum_PHUM466000
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Phum_PHUM466000
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM466000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 550 aa AA seqDB search
MFERKRYGKFGPIVGAIDEGTSSTRFLAFAADTSEVLTFHQIDIPQKCPQENWVEQDPMD
ILDAVRECIEKTIYNLRKLDINPNDVVAIGITNQRETTILWDKLTGKPLYNAILWLDMRT
SSTVDKVLLKVKNKDPEYLKPLCGLPISTYFSALKIKWLIDNVEEVRVAIKENRCLFGTV
DTWLIWNLTGGPNGGHHVTDVTNASRTMLMNISTLKWDARLCDFFDVPLSILPQIYSSSE
IYGYLTEKALLGIPISGCLGDQQSALVGQMCFKQGQAKNTYGTGCFLLYNTGTLMVQSNH
GLLTTVAYKLGKNAHPVYALEGSVAIAGAAMKWLKDNLEFFKDEKETSKLVEKCQGSSDL
YFVPAFSGLYAPYWRKDARSVICGLTEETSKQHIVKAAMEAACYQTRDILEAMNKDCGIP
LQKLLVDGGMTVNNYIMQLQADLCGIPVVRPIMTETTALGAAMMAGMAEGINVWDLQNTP
KVVCDTFTPSISEDERDLKYSRWKMAIERSLNWEPESNEEKKKKTKLNPVMPAIYMMFSL
TILLWAKHHN
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaacgtaaaagatatggaaaatttggcccaattgttggagcgatcgatgaagga
acaagtagtactagatttttagcctttgctgcagatacttctgaagttttaacatttcat
caaattgatattcctcaaaaatgtcctcaagaaaattgggtcgaacaggaccccatggat
atattagatgctgttagagaatgtattgaaaaaactatttataatttaagaaaattagat
attaatcctaatgatgttgtcgctattggtattactaatcaaagggaaacaactattttg
tgggataaactcactggaaagcctctatataatgctattttatggttagatatgagaact
tcttcaacagtagataaagttttacttaaagttaaaaataaagatcctgaatatttaaaa
ccattatgtggtttgcctataagcacttatttcagtgctttaaaaattaaatggcttata
gataatgtagaagaagtaagagtagctataaaagaaaatagatgtctttttggcacagtc
gacacttggcttatatggaatttaacaggtggtccaaatggtggtcatcatgttacagat
gttacaaatgcttctagaacaatgcttatgaatatctctactttaaaatgggatgctagg
ctgtgtgacttttttgatgttccattgtcgatattgcctcaaatatacagttcctctgaa
atatatggttacctcactgaaaaagcactgttaggaataccaatctctggatgtttagga
gatcaacaatctgctcttgttggacaaatgtgttttaagcaagggcaagcaaaaaacact
tatggaacaggatgttttttactgtacaacactggaactttgatggttcaatctaatcat
ggattattaactacggtagcttataaattaggaaaaaatgctcatcctgtatatgcatta
gaaggctcagtggccatagcaggggcagctatgaaatggttgaaagataatttagagttt
tttaaagatgaaaaagaaactagtaaattagtagaaaagtgtcaggggtcaagtgattta
tattttgtacctgctttttctggactttatgctccttattggagaaaagatgctagaagt
gttatttgtgggcttaccgaagaaacttctaagcagcatatagtcaaagctgcaatggag
gctgcttgttaccaaaccagggatatattagaagcaatgaataaagattgtggtattcca
cttcaaaaattgttagttgacggagggatgactgttaataattatataatgcaattacaa
gctgacctatgtggaataccagtagttcgaccaataatgacagaaactacggctcttggg
gcagctatgatggctggaatggcggaaggaataaatgtttgggacttgcagaacacgcca
aaagttgtttgtgatacctttacaccttctatatcagaagacgaaagagatctgaagtac
agcaggtggaaaatggctatagagagaagtttgaattgggagccagaatcaaatgaagaa
aaaaaaaagaaaacaaagttaaatcctgtaatgccggccatatacatgatgttttcctta
acgattttgctttgggctaaacaccacaattag

DBGET integrated database retrieval system