KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM467120Help
Entry
Phum_PHUM467120   CDS       T01223                                 

Definition
Keratin, type I cytoskeletal, putative
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Phum_PHUM467120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 355 aa AA seqDB search
MYAKDKNAQLTSSQVNQSEAGPDIVDVNPTFLKNTQAAENNEELNLQTKNAKEPNLVNKN
GGKEHIIYSQQSTNPAIEVLDRLISLSPSSKESVNSYKNERNFVSDRDEKNLFKLDGIEQ
TVLEIELEKLHNLLLKQEKTNQEKVSDYETHLTKLTGQTCILQDQLKQAEDREKALVKKV
NEQNQNHVQLSIVMQEYEKLISKLTAEIETEKRGNKEKIENLTAEKDSALQHLTNVEAAF
TDVHQKYEKCKKVIEDYKKNEAKLKSLISDQIDTLKIKEKQLETIQVHASKQLENAHIEV
ERSRQNHEQEMTRLRALLRKTELKVMSLQESLEQKIKENQELTTICDDLIEGKKP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctaaagacaaaaatgcacaattaacctcttcacaagttaatcaaagtgaagca
gggcctgatattgttgatgtaaatcctacatttttaaaaaatactcaggctgcagaaaat
aacgaagaactaaatcttcaaactaaaaatgctaaagaacctaatttggtaaataaaaat
ggtgggaaagaacatatcatatattctcaacaatctacaaatccagccattgaagtcttg
gaccgcttgatatctttgagtccttcatctaaggaatctgtcaactcatataaaaatgaa
aggaattttgtttctgatagagatgagaaaaatttatttaaattagatggcattgagcaa
actgttttagaaattgaacttgaaaaactgcataacttattattaaaacaagagaaaact
aatcaggaaaaagtaagcgattatgaaacacatttgacaaaattaacaggtcaaacctgc
atacttcaagatcaattaaaacaagcagaagatagggaaaaggctctggttaaaaaagtg
aatgaacaaaatcagaatcatgtacaattgagtatagttatgcaagaatatgagaaatta
atttccaaattaacagcagaaattgaaacagaaaaaaggggaaataaagaaaaaatagaa
aatttgactgcagaaaaagactcagcattacagcatttaacaaatgtcgaagctgcattt
acagatgttcatcaaaaatatgaaaaatgtaagaaagtcattgaagattataaaaaaaat
gaagcaaaattaaagagtttaataagcgaccaaatagacacattgaaaattaaagaaaaa
caattggaaaccattcaagtgcatgcatcaaaacaattagaaaatgcacatatagaagtt
gaaaggtcgagacaaaatcacgaacaagaaatgacaagattaagagctttgttgaggaaa
actgaattgaaagtaatgtcattacaagaatcccttgaacaaaaaattaaagaaaatcaa
gaattgactaccatttgtgatgacctcatagaaggcaaaaaaccataa

DBGET integrated database retrieval system