KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM470220Help
Entry
Phum_PHUM470220   CDS       T01223                                 

Definition
Alanine aminotransferase, putative (EC:2.6.1.2)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Phum_PHUM470220
   01210 2-Oxocarboxylic acid metabolism
    Phum_PHUM470220
   01230 Biosynthesis of amino acids
    Phum_PHUM470220
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Phum_PHUM470220
Enzymes [BR:phu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Phum_PHUM470220
Amino acid related enzymes [BR:phu01007]
 Aminotransferase (transaminase)
  Class I
   Phum_PHUM470220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 485 aa AA seqDB search
MSTAGKSNEKCVTIENMNENIIRLEYAVRGPIVIRAGEIEKELEQGVKKPFTEVLKANIG
DCHAMGQKPITFFRQVLALVSLPSLFDDPSFPEDAKDRARGVLKGCKGGSVGSYTDSVGI
EIIRKHVAEFIERRDGIPSDYANIILSAGASDGIKNVLKIMNQPIDNKRPGVMVPIPQYP
LYSATLAEFNMHQISYYLNESKGWGMDLSELQRAVDEAKEVSAPRAIVVINPGNPTGQVL
SRKNIEEIIQFAYKERLFILADEVYQDNIYAPGSKFYSFKKVLTEMGPPYSEMELASFMS
CSKGYMGECGLRGAYFEIINICPQVKAQLLKAISAMLCPTALGQTVVECIVNPPREGEPS
YPLYKEEREQVLSELKKRAKMVADTFNSIPGFSCNEVQGAMYAFPQMQLPPKAVEAAKKE
GKAPDTFYALQLLENTGICIVPGSGFGQQPGTHHFRTTILPQTDKLKAMLDTFKTFHKKF
LKEYS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgccggaaaatcgaatgaaaaatgtgtcacaatagaaaatatgaacgaaaat
ataattcgtttggaatatgccgttcggggaccgattgtaattagagctggagaaatagaa
aaagaattagaacagggtgtcaaaaaaccttttacagaagttttaaaagcaaatattggt
gattgtcatgccatgggacaaaaaccaattactttttttagacaggttttggctcttgtg
tcattaccatcactttttgacgatccgagttttccggaagatgccaaagatagagcgaga
ggcgtgcttaaaggttgtaagggaggaagcgtgggttcatacacggattctgtcggaatc
gaaataattcgaaaacacgttgccgaatttatagaaagacgagatggtataccgagcgac
tatgcaaacatcatactatcggcgggagcttctgacggtatcaaaaatgttttgaaaata
atgaatcaacccatcgacaacaaacgacccggagtcatggtacccataccacaatatcca
ctctattcggcaaccctcgcagaattcaacatgcatcaaataagttattatttgaacgaa
tcgaaaggttggggtatggatttgagcgagttgcaaagagccgtagacgaagcgaaagaa
gtctccgcaccgagagccatagtcgttataaatcccggaaatcccacgggacaagtactc
tctaggaaaaacattgaagaaataatacagtttgcgtacaaggaaagattgttcatattg
gccgacgaagtttatcaggacaacatatacgctcccggaagtaaattttattcatttaaa
aaagtattaacggaaatgggtcctccctacagcgaaatggaattggcatcgttcatgtct
tgttcgaagggttacatgggggagtgcggattgagaggagcttatttcgaaattataaat
atttgccctcaagtgaaagctcaacttttgaaagccatttcggccatgttgtgtccgact
gctttgggtcagaccgtcgtcgaatgcatcgtgaatcctccgagagaaggagaaccaagt
tatcctttgtacaaagaagaaagagaacaagttttgtcggaattgaaaaagagagcgaaa
atggttgccgacacattcaacagcatacctggattttcatgcaacgaagtccagggtgcc
atgtacgctttcccacaaatgcaattaccaccgaaagccgtggaagcagcgaaaaaagaa
ggaaaagctcctgatacgttttacgctttgcaattgttggaaaataccgggatttgcatc
gttcccggatccggattcggtcaacaacctggaacgcatcattttaggaccacgatatta
ccgcaaacggataaattaaaagccatgttggacacgtttaaaacttttcacaaaaagttt
ttaaaagaatactcgtag

DBGET integrated database retrieval system