KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM472630Help
Entry
Phum_PHUM472630   CDS       T01223                                 

Definition
(RefSeq) fatty acid desaturase, putative
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu01040  Biosynthesis of unsaturated fatty acids
phu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Phum_PHUM472630
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Phum_PHUM472630
Lipid biosynthesis proteins [BR:phu01004]
 Desaturase
  First
   Phum_PHUM472630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 8238945
NCBI-ProteinID: XP_002430307
VectorBase: PHUM472630
UniProt: E0VW13
AA seq 399 aa AA seqDB search
MTTTMSEELIFCPGLDASFTKPSVIYETVSVKKPEMQKEKKDYQKKKMKTTTTTQPGMGI
FEFQTKIVWFNAIGFLLMHLAGFYGISLSLWDMTKGRFLTFGWMFFLVFLGGEGITVGAH
RLWSHRSFKATKPLQIILIIMQTLAGQNCCYIWARDHRQHHKYSDTDADPHNASRGFFFS
HIGWLMMKKHPEVIRKGKGVDMSDLEANPIIMFQKKYYKSLYFIIAMIIPVFVPVYFWNE
PFWKSVFVNYFGRYILLLNITWSVNSVAHMFGTKPYDKNILPVESTFVSFIGLGEGWHNY
HHVFPWDYKASEFGMPLNFTAHLIEFLAKVGLAYDLKEVTENVMENRIKRSGDGSHPVYG
LLKDISTDFRENECEKNYESENLGNEIDAEKDSSVKKQS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgactacaacaatgagcgaagaattaattttttgtcccggtttggacgcatcatttaca
aaaccatccgtcatatatgaaaccgtttctgtgaaaaaaccagaaatgcaaaaagaaaaa
aaagattatcaaaagaaaaaaatgaaaacaacaacaacaacccaaccggggatggggatt
ttcgaatttcaaacgaaaattgtttggtttaatgccatcgggtttctactcatgcatttg
gctggattttatggcatatcgttaagcctttgggatatgacaaaaggacgatttctaacc
tttggatggatgttttttttagttttcctcggtggagaaggtataaccgtcggtgctcac
agattatggagtcatagatcattcaaagctacaaaaccactgcaaatcatattgatcata
atgcaaactttggcaggacagaattgttgttacatatgggcaagagatcacaggcaacat
cacaaatacagtgacacggatgcagatccacacaatgcaagcagaggattttttttttca
cacattggatggttgatgatgaaaaaacatcccgaagttattagaaaaggaaaaggagtt
gatatgtcggatttagaagccaatcccataatcatgtttcaaaaaaaatattacaaatcc
ttatattttataattgctatgattatcccggtgtttgtacctgtttatttttggaacgaa
ccattttggaaatcggttttcgtcaattatttcggtcgttacattttacttttaaacata
acatggagtgttaatagcgtggcacacatgtttggaacaaaaccatacgacaaaaatata
ttaccggtcgaaagtactttcgtttcgtttatcggattgggagaaggttggcataattac
catcacgttttcccgtgggattacaaagcgtcagaatttggaatgccgttaaatttcacc
gctcatttaattgaatttttggctaaggtgggattggcttacgatttgaaagaagtcacg
gaaaacgttatggaaaatagaataaaaagatccggggatggaagtcatccggtttacggt
ctgttaaaagacatttcaaccgattttagagaaaacgaatgtgaaaaaaattacgaatcg
gaaaatttgggtaatgaaattgacgcggaaaaggattcgtcggttaaaaaacaatcgtag

DBGET integrated database retrieval system