KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM479110Help
Entry
Phum_PHUM479110   CDS       T01223                                 

Definition
malonyl-CoA decarboxylase, putative (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Phum_PHUM479110
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Phum_PHUM479110
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Phum_PHUM479110
Enzymes [BR:phu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Phum_PHUM479110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 485 aa AA seqDB search
MEDDCKYPDIFSNEDFVQRRLSTFEDVQVCISLLKEVLEYRKKNISSWIVESKVKQLCSF
YKCLIKNHRNEFIQVLSKDYAVNHYKVFQLSETLAKCSNISESDAKSDAKILKNEDQLRT
ILTPQYSWLFLNIGKLEKGVKFLVDLRTDVLELIAEKNSEVDSTVELQQLNSTLRDLLSL
WFSIGFLQLQRVTWNSPCEMLQKISEYEAVHPVRSWTDLKRRVGPYRRCFVFLHGSMPGE
PIVVLHTALCDEIASSMSGIEEDATCVKAAVFYSISSTQKGLQGIELGNYLIKSVVHELQ
IEFPQMTQFSSLSPIPNFKTWLIDKVKFAEKGSNDILLHDEIITLKKHLNSSSDFWKDFK
KILLSNAWAEDKNLVSLLEKPLMRLCARYLFIEKRRGYAFDSVANFHLKNGAVLWRLNWS
ADLSPRGLGNSCSMMVNYRYFLEDTESNSRAYLENFSIPASEQILNLAEQAKQKIVCNSD
SWKYL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgattgtaagtatccggatatattttctaatgaggactttgttcaaagaaga
ctaagcacatttgaagacgttcaagtatgcatttctttacttaaagaagttttggagtac
cgtaaaaaaaatataagcagctggattgtagaaagtaaagtaaaacaactatgtagtttt
tacaaatgtttaattaaaaatcatagaaatgaatttattcaagttttatccaaagattat
gccgtcaatcattataaagtatttcaactttccgaaacattagcaaaatgcagtaatata
tctgaaagtgatgctaaatctgatgctaaaattttaaaaaatgaagatcaacttagaaca
attcttacacctcaatattcatggctttttttgaatattggaaaacttgagaaaggagtc
aaattcttagtcgaccttaggactgatgtattggaactaatcgctgaaaaaaattcggaa
gttgatagtacagtagaactgcagcaactaaattcaaccttaagagatttgctatcttta
tggttttcaataggttttttacaacttcaaagagttacttggaattcaccatgtgagatg
cttcaaaaaatttctgagtatgaagctgttcatccagtaagaagctggacagatcttaaa
agaagggttggtccttatagaagatgctttgtttttcttcatggtagtatgcctggtgaa
ccaattgtggttttgcacactgctttgtgcgatgaaatcgcttcaagcatgtctggcata
gaggaggatgcgacatgtgttaaagctgctgtgttttattccataagttcaacccaaaaa
ggattgcaaggaatagaactagggaattatttaattaaaagtgttgttcatgaattgcaa
attgaatttcctcaaatgactcaattttctagtttgtcccctattcctaattttaaaaca
tggctgatagacaaagtaaaatttgcagaaaaaggttcaaatgacattttactacatgat
gaaataattactttaaaaaaacatctaaattcttcatcggacttttggaaagattttaaa
aaaattttactttcgaatgcttgggcagaagataaaaatttagtttcgcttctagagaaa
ccattgatgaggctttgtgctcgatatctatttattgaaaagagaagaggttatgctttt
gatagtgtggcaaactttcatttgaaaaatggtgcagttttatggagattaaactggtct
gctgatctttctcctagaggtttaggaaattcttgcagtatgatggtgaattacagatat
tttttagaagatactgaatccaatagtagagcttacttagaaaattttagtattccagca
tctgaacaaatattaaatttagctgaacaagctaaacaaaaaatagtatgcaatagtgac
agttggaaatatttatga

DBGET integrated database retrieval system