KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM488870Help
Entry
Phum_PHUM488870   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Phum_PHUM488870
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Phum_PHUM488870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1127 aa AA seqDB search
MLRKVKSISGQVHQTKKRKLVMRFARRILHLKKDTSSMQLQVLEPPAEYLEEDITSKYDQ
GLPPDALYLLQSLRVFGHFEKPVFLMLCKHTEILTVPAGAFLFKIGDPDENVYVVQSGCL
NVFITEHNGTMISLKYVKAGESVTSLLSFTDVLTGSPSVYKTVSARAMEDTTIVRLPIQA
FNEVFHDYPDIFIRVVQVIMVRLQRVTFTALHQYLGLSAELVRSNTHFVNNYQTINTSQK
SQRSSLGEENNEVTKIRNVPFSGPLDFKIINQKFVPFSEIFLRQNAKIFATNAGNQNAPI
ESEIQMTGHRRSMSGKVNSLAEDYDSLMQLAKAAFVRELNLENESILDGKIEIKDVPTGT
YLMRQDSHKDVALIYLLSGALVLSQKMTDDQHEVHMFTAHPGEVIGGLAVLTGEPSFFTM
KAKHFSKIAMLSKSTFYEIVYLHKTVYILLFNNESVSQSSFICSPYRKLVGEYGKGDLVG
IVEMVTQTPRSTTVMAVRDSELAKLPEGLFNAIKLRFPIVVTRLINLLGHRLLGTKGHPG
VGLNPGAGARPSQVNFSTVAIVPISDDVPLTAFGFELYHALCAIGLTLRLTSDLIKKTLG
ATIMDPNNEYRLTSWLAQQEDQHKIALYQCDASLTPWTQRCVRQADCILIIGLAEKGPDL
GKMEKEVERLAVRTQKELVLLHRESTERPSNTVLWLNARTWVSSHHHIKCNKRMFSRRSQ
YRINELYKKVLMSEPNIHSDFSRLARWLTGTSVGLVLGGGGAGIPIDMVGGVSIGSFVGG
LWAMEKTLRRDSKAREWSKKMTQWYRQILDLTYPVVSIFTGKDFNHTIYSTFGDINIEDL
WIPYFNVTTDISASASRVHKHGFLWKYIRASMSISGVLPPICDPVDGHLLCDGCYVNNVP
ADVMRNEGARHILAIDVGAHDDQDLTNYGDSLSGFWLLYKKWNPFTKPVKVPDLSDIQSR
LSYVCCVRQLEEVKNSDYCEYLRPPIDKYKTLQFALFDEIKEVGYTYGKTYFARLLKAGV
LPLFKTDIVATRRPFASHPTYTFTDLAQMVCKVPRKHVTADMSSSTSETEDDDDDDDDIN
VGYASEPSAFILSKNSTANVPRRGQSLSENELDSETNFLTDEASDAR
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgcttagaaaagttaagtcaatatcaggtcaagttcatcaaaccaaaaaaagaaaatta
gttatgagatttgccaggagaattttacaccttaaaaaagatacttcatcaatgcaatta
caggtactggagcctccagcagaatatttagaagaagatattacaagtaaatatgatcaa
ggacttcctcctgatgcactgtatttattacagagtttaagagtttttggacattttgaa
aaacctgtttttcttatgttatgcaaacataccgagattttaacagtacccgctggtgca
tttctttttaaaattggtgatcccgatgaaaatgtttacgttgttcaaagtggatgttta
aatgtatttataacagagcacaatggaaccatgatctcacttaaatatgttaaagctgga
gaatcagttacctctttacttagttttacagatgtccttacagggagtccaagtgtatat
aaaacagtatctgctagagcaatggaagatacaacaattgttcgtttgccgatacaagct
tttaatgaagtttttcatgattatccagatatatttattagagtagttcaagttataatg
gttcgacttcaaagagtcacatttactgctttacaccaatatttaggtctttcggcagaa
cttgtcagatcgaatacccattttgttaataattatcaaacaattaacacgagtcaaaaa
agtcaaagatcctctcttggggaagaaaacaatgaagttaccaaaattcgtaatgtccct
ttttctggtccgcttgattttaaaattataaatcaaaaatttgttcctttttcagaaata
ttcctgcggcaaaatgccaaaatttttgcaactaatgctggaaatcaaaacgctcctatt
gaatcggaaatacaaatgactggtcacagaagatcaatgtcaggaaaagtgaattcccta
gctgaagactacgactctttaatgcaattggcaaaagctgcgtttgttagagaattaaat
ctcgagaatgaatcaatattagacgggaaaattgaaatcaaagatgttcccacgggaaca
tatttgatgcgacaagattctcataaggatgttgcattaatttacttactatctggtgca
ctagtactatcacaaaagatgacagatgatcaacatgaagttcacatgtttaccgctcat
cctggagaagttattgggggtttagcagttttaactggagaacctagtttttttacaatg
aaagctaaacatttttcaaaaatagccatgctttccaaaagtactttttatgagatagtt
tacttacataagactgtttacattttattgttcaataatgaaagtgtatcccaaagtagt
tttatatgtagcccataccgtaaattagtcggggaatatggtaagggtgatttagttggc
atagtcgaaatggtcacgcagacaccaagaagtacaacagttatggctgttagggattcg
gaattagcaaaattaccagaaggacttttcaacgctataaaattaagatttcctatagtc
gtaacaagattaattaatttattaggtcataggttattgggtactaaggggcatcctgga
gttggattgaatccgggtgctggagctcgaccatctcaagtaaatttttcaactgtagct
atagttcctatatctgatgatgtgcctttaacagcttttggatttgaattatatcacgcg
ctttgcgccattggtttaacgctacgactgacgtcagatttaattaaaaaaactttaggt
gccacaataatggatcctaataacgagtatcgtttaacgtcttggttagcacaacaagaa
gatcaacataaaattgcactctatcaatgcgatgcctcacttactccgtggactcagcgt
tgcgttcgtcaagcagattgcatattaataattggtctagctgaaaaaggaccggattta
ggaaagatggagaaagaagttgaaagattagccgtaagaacacaaaaagaattggtactt
cttcatcgggaaagtaccgaaaggccaagcaatacggtgctgtggctcaatgccagaact
tgggtatcttctcatcaccacattaaatgcaataaacgaatgttttcaagaagatctcaa
tatagaataaatgaattatataaaaaagttctcatgtcagaaccaaatatccattccgat
ttttcaagattagccagatggttaactgggacttctgttggtttggtgttgggaggaggc
ggagctggaattcccattgatatggtcgggggtgttagtatcggatcatttgtcggtggc
ctttgggccatggagaaaacattacgacgtgactcaaaagcgagggaatggtctaaaaaa
atgactcagtggtatagacaaattttagacctaacttacccggtagtttcaatatttaca
ggaaaagattttaatcacactatatacagtactttcggtgatataaacattgaagattta
tggattccttattttaatgtcacgaccgatatttctgcgagtgcaagtcgagtacataaa
cacggttttctatggaaatacatacgagcgagcatgtcaatcagcggagtccttccacct
atctgtgatccagtagacgggcatctgctttgcgatgggtgttatgtcaataacgtgcca
gctgatgttatgagaaacgaaggagctcgtcatattcttgccatcgatgtgggtgctcac
gatgatcaagatttaaccaattacggagattctttatccggtttttggcttttgtataaa
aaatggaatccttttaccaaacctgttaaagtacctgatttatcggacatacaatcgagg
ttgtcgtacgtttgttgcgtacgacaattggaagaagttaaaaatagcgactattgcgaa
tatctaaggccaccgatagacaaatacaaaacattacaatttgctctcttcgatgaaata
aaggaagttggttacacttacggtaaaacttattttgcgagattattaaaagcgggtgtg
ttaccacttttcaaaactgatatcgttgctacgaggcggccatttgcaagtcatccaact
tatacatttaccgatttagctcaaatggtttgcaaagtaccgagaaaacacgttactgct
gacatgtcatcaagcacgtctgaaactgaagatgatgatgatgacgatgacgatataaac
gttggttacgcgtctgaaccttcagcctttatactttccaaaaattcaacagcaaacgta
ccgcgaagaggtcaatcattatctgaaaatgaacttgattccgaaactaattttttaacc
gacgaagcatcggatgcaaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system