KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM489270Help
Entry
Phum_PHUM489270   CDS       T01223                                 

Definition
mRNA-associated protein mrnp, putative
Orthology
K14298  
mRNA export factor
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Phum_PHUM489270
Messenger RNA biogenesis [BR:phu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Phum_PHUM489270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 365 aa AA seqDB search
MFNQSGLGGTTFGLPGATVSQTTHNPMKDFEVTSPPDDSVSSIAFSPASLPQNFLIAGSW
DNNVRCWEVEQSGKTIPKSIQSMDGPILDVCWSDDGTKVFMASCDKQVKAWDLASNQTIQ
VAAHDAPVKTCHWVQGGVYSCLMTGSWDKTLKFWDTRTPNPIMTINLPERVYCVDVDYPM
AVVGTAGRSIIVYQLEGKPQEFKRMESPLKYQHRCIAIFRNKKKIPTGFAIGSVEGRVAI
QYVTPASPKENFSFKCHRVANNTVNGYHDIYAVNDLAFHPVHGTLATVGSDGTISFWDKD
ARTKLKPFEPLDQPIVACAFNHNGHIFAYAASYDWSKGHEYYNPAKKSAIFLRSCFEDMK
GRASS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatcaaagtggattaggagggaccacgtttggtttacccggagcaacggtgagt
cagacgacacacaatccaatgaaagatttcgaagtgacgtcgccgccggacgattcggta
tcatcgattgcattcagtccggcatcgttaccgcaaaattttttaattgccggaagttgg
gataacaacgtgaggtgttgggaagtcgaacaatccgggaaaacaataccgaaatccatt
cagtctatggatggacccatactggacgtttgctggtccgacgacggaacaaaagttttc
atggcttcctgcgacaaacaagttaaagcttgggatttggcgtctaatcaaacgattcaa
gtggctgcccacgacgctcctgtaaaaacatgccattgggtacaaggcggagtttattct
tgtctcatgaccgggtcgtgggataaaacgcttaaattttgggacacgcgaacgcccaat
cccataatgacaataaatcttccggaaagagtgtattgcgtcgacgtagattatcctatg
gccgtcgtcggaaccgccggaaggagcataattgtttatcagttggaaggaaaaccacag
gagtttaaaagaatggaatccccgttgaaataccagcacaggtgcatcgcaatatttcga
aacaaaaagaaaattccgacgggattcgccatcgggagcgtcgaaggtcgcgttgccata
caatacgtcactccggcatcgcccaaagaaaatttctcatttaaatgtcatcgagtcgcg
aacaacaccgtcaacgggtaccacgacatttacgccgtcaacgatttggcttttcatccc
gtacacgggactcttgccactgtgggctcggacggaacgattagtttttgggataaagat
gccaggacgaaattaaaacctttcgaaccgttagatcagcccattgtggcatgcgcattt
aatcacaacggtcacatattcgcgtacgcagcttcgtacgactggtcgaaaggacacgaa
tactataatccggctaaaaaaagtgccatatttttaagatcttgtttcgaagacatgaaa
ggtagagcctcgtcgtag

DBGET integrated database retrieval system