KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM490200Help
Entry
Phum_PHUM490200   CDS       T01223                                 

Definition
acetylcholinesterase, putative (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:phu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 821 aa AA seqDB search
MLTEANISYNDFRNTVAFNEYNEKIDNRRIEEAKRYLDLTRNKLEKSKKIKDSFQSAESS
SRDVHFSKDRGEREENGEDKEWEKTISNLSVTKTKGEIRETIKNVVERRKKDGKMLKKDI
QGVVKKRGRSTDTQDEIIKRNLELQRTIRSRENKQPHEESGGGGGGGGGGNVGSGTGGGA
SVQTQSAHFVEHDSLKFSERNNLGLGEGNMHLNRKDRSEFGAQNKDLKNDYRFVDDKKND
PLIVSTTKGKVRGVTLQGANGKYVDAWLGIPYAQKPIGNLRFRHPRPIEKWDPEIFNATK
PPNSCVQILDTVFGDFPGATMWNPNTPLSEDCLYINVVVPKPRPRKSAVMVWIFGGGFYS
GTATLDVYDPKTLVSEENVIVVSMQYRIASLGFLYFGTPDVPGNAGLFDQLMALQWVHDN
IRSFGGNPYNVTLFGESAGAVSVSTHLLSPLSRNLFSQAIMESGSPTAPWAIIPTEESIL
RGLRLAEAVNCPHDRFQLSAVIECLRNTNASLLVNNEWGTLGICEFPFVPVIDGAFLDEL
PELALANKNFKKTNILMGSNTEEGYYFIIYYLTELLRKEENVYVNRDEFIKAVRELNPYI
NNIARQAIIFEYTDWLNPDDPARNRDALDKMVGDYHFTCSVNEFAHRYAETGNKVYMYYF
THRSAGNPWPSWTGVMHGDEINYIFGEPLNPLKNYRVEEQELSRRIMRYWANFAKTGNPS
MSEDGTWTPVVWPEHTAHGREYLTLAVNNTSTGRGPRLKQCAFWKKYLPQLLALTKNIKS
NNQIQNCQSKGSKSTFLHFSHFIPPYFTLLLLLLLSGGKIF
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgttgactgaagcgaacatcagttacaacgattttcgaaacacagtagccttcaatgaa
tacaatgaaaaaattgacaatcgtagaatagaagaagctaaaagatatttagacctaacg
cgtaataaattagaaaagtcaaaaaaaataaaggacagttttcaaagcgctgagtcaagt
agccgagacgtccacttttcaaaagacagaggagagcgagaggaaaatggtgaggacaaa
gagtgggaaaaaacaatatcgaatttatcagttacaaaaacaaagggagaaattagagaa
actattaaaaatgtggtcgaaagacgaaagaaggacggtaaaatgttaaaaaaagatata
cagggggttgttaaaaaaagaggacggtcaactgacacacaagacgaaataataaagagg
aatttagagttgcagaggacaattagaagcagggaaaataagcagcctcacgaggaaagc
ggtggaggtggtggtggtggtggtggcgggaacgtcgggagcgggaccggtggtggtgct
agtgttcaaactcaaagtgctcattttgttgaacacgattctttgaaattcagtgaaaga
aacaatttagggttaggtgaaggaaatatgcacttaaatagaaaagatcgatccgaattc
ggagcccaaaataaagacttgaaaaatgattatcgctttgttgatgataaaaaaaatgat
ccactcattgtatcgacaacaaaaggtaaagttcgtggagtcactcttcaaggagctaat
gggaaatacgttgatgcgtggttaggaataccctacgctcaaaaaccgatcgggaaccta
cgatttcgtcatccgagacccattgaaaaatgggatccggaaatattcaatgctacaaag
ccaccaaacagttgcgtgcaaattttagatactgtttttggtgattttccgggcgcgacc
atgtggaatccgaacactccactttctgaagattgcctctacataaatgtagtagtgcct
aaacccagaccccgtaaaagcgctgtgatggtatggattttcggtggaggtttttattcc
ggcacggcaaccctcgacgtttacgatccgaaaactttggtgagtgaggaaaatgtaatc
gtcgtatccatgcaatatcgaatagcatctctcggtttcctatatttcggaactccagac
gtgcccggaaacgcaggtttatttgatcaattgatggctcttcagtgggttcacgataac
attcgttctttcggaggaaatccatataacgtcacattgttcggagagtcggcgggagcg
gtgtccgtgagcactcatctattatctcctctcagcagaaatttatttagtcaagcgatc
atggaatccggatctcctacggctccttgggcaattataccaacggaagaaagcatattg
cgaggccttcgccttgccgaagctgtcaattgtcctcatgatcgttttcaattgtctgcc
gtcatagaatgtttgcgtaatacaaatgcttcacttttagttaataacgaatggggaact
cttggaatttgcgaattccctttcgtacccgttatagacggagcatttttagacgaatta
cccgagttagcattagcgaataaaaatttcaagaaaacaaatattctaatgggttccaac
acggaagaaggatactactttattatatattatctaactgaattgcttagaaaagaagaa
aacgtttacgtcaatagagacgaattcataaaagcggtaagagaattaaatccgtacata
aataacatagcaaggcaagcgatcatattcgaatataccgactggttaaatccggacgat
ccggcacgtaatagagatgctttagataaaatggtcggagattatcattttacatgtagc
gttaatgaattcgctcatcgatacgcggaaacaggaaataaagtttacatgtattatttc
actcaccgaagcgccggaaatccatggccatcttggacgggtgtcatgcacggtgatgaa
attaattacatatttggcgagcctttaaatccacttaaaaattatcgagtcgaagaacag
gaactcagcaggcgaatcatgagatattgggccaattttgctaaaacaggaaatccgagc
atgtccgaagatggaacatggactcctgttgtatggcccgaacacactgcacacggtaga
gaataccttacattagcagtgaataatacgtctacgggaaggggtccaaggcttaaacag
tgtgcattttggaaaaaatatttgccccaattattagcactaacaaaaaatatcaaatct
aacaatcaaatacaaaattgtcaatcaaagggttcaaaatcaacatttttacattttagt
cattttattccaccttatttcactttattattattattattattatcggggggaaaaata
ttttaa

DBGET integrated database retrieval system