KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM492330Help
Entry
Phum_PHUM492330   CDS       T01223                                 

Definition
dual specificity mitogen-activated protein kinase kinase, putative (EC:2.7.12.2)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Protein processing in endoplasmic reticulum
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Phum_PHUM492330
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Phum_PHUM492330
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Phum_PHUM492330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 772 aa AA seqDB search
MSKPSSYLADKIDALENKFKVENEKDKDKASKEYNGGLDAPRAGSGRRPRNLTELSMSGG
TQSTRTPKKLLDLPMFPVQQRVSNTGEIDRKMQDIMKLTGILEINGKKYETDIKDLDHCG
DLGNGTCGHVVKMLHRPSQTVIAVKQMRRSGNSEENKRIVMDLEVVLKSHDCPYIVQCLG
CFITESDVWICMELMATCFDKLLKRLKISIPEDILGKVTYATVKALDYLKEKHGVIHRDV
KPSNILLDERGNVKLCDFGISGRLVDSKPQTTSAGCAAYLAPERIAPQNPSKPDYDIRAD
VWSLGITLVELATGEFPYKNCKSDFEVLAEVVDGEPPKLPQDRNFSPEFISFVNSCLTKN
YKERPKYRKLLDHPFMKMSEESKADVADWFAKTVPVTDMNLTGNSPIRRLCMRFPTPATS
SSSSSASSTSSSASTPSSTRYNSNYIVNLNNEKSSELKFSQVNNNNSKGKITEIHFPPRN
NERSTVAAITQKLESSHVSSTSGHVRHCDIYENRRRFFSQEPVVINGGSDLQKTWHQPKP
PTHSHSHHHHHHHHHHFRSYPNQSFTNHQVPDNTLEPWRSYSPSRDSNNSNESSQCYSET
NNTDHNHQVDGKSHEDTSKKRFSSYLKFHLGGKEESKRYNCLSSSFNNSKSTRVQSTSNP
RVQSTLQISQPSQSPEPPPRYNRFTSQGEESGSPLPMKRGFLDHSPLRKGLVEGSPSLSR
RYVSPSPPQPPPRRLSDCNSVPGSPQHRQVEHYRARFHYTPEPQRRLFRTEF
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcctagttcttatttagctgataaaatagacgcattggaaaataaatttaaa
gtagaaaatgaaaaagataaggataaagcgtctaaagaatataatggcggtttggatgct
cctagagctggttcagggcgtagaccgagaaacttgactgaattatcaatgtcgggtgga
acgcaatcaacgagaactcctaaaaaattgttagatctgcccatgtttccagttcaacaa
agggtatctaatacaggagaaatagataggaaaatgcaagacattatgaaattgactggt
attttagaaattaatggaaaaaaatatgaaactgatataaaagatcttgatcactgcggt
gatctcggtaatggaacttgtggtcatgttgtgaaaatgttacataggcctagtcaaaca
gttatagcggttaaacaaatgagaaggtctggcaacagtgaagaaaataaaagaattgtt
atggatttggaagtagttttaaaatcacatgattgtccctatattgtacagtgtttaggt
tgtttcataacagaatccgatgtttggatttgtatggaactaatggcgacatgttttgat
aagctacttaagagacttaaaatatcaatacctgaagacatattaggaaaagttacttat
gctactgttaaagctctagattacttgaaagaaaaacatggagtaatacatagagatgtt
aaaccatcaaatattcttctcgatgaaagaggaaatgtgaaactctgtgattttggtatt
tctggtagattagtcgattcgaaacctcaaactacgagtgctgggtgtgctgcttactta
gctcctgaaagaatagctccacaaaatcctagtaaaccagattatgacatcagagcagat
gtttggagtttaggaataactttagtcgaacttgcaactggtgaattcccttacaagaac
tgcaaatctgattttgaagttcttgccgaagtcgtagacggagaacctcccaaactgcca
caggatcgaaactttagtccagaatttattagttttgttaattcttgtttaacaaaaaat
tacaaggaaagaccaaagtatcgaaaattattagatcatccatttatgaaaatgtcggaa
gaatctaaagctgatgttgctgattggtttgcgaagactgtacccgtaaccgatatgaat
cttactggaaattcccccataaggaggttgtgcatgagatttccaactcctgctacgtca
tcatcttcttcatccgcctcatcgacgtcatcatcagcatccacaccatcatcaacaaga
tataattctaattatatagttaatttaaataatgaaaaatcttcggaattaaaattttca
caagttaataataataatagtaagggaaaaataacggaaattcattttccaccaagaaat
aatgaaagatcaaccgttgccgccataacacaaaaattagaatctagtcatgtatcatca
acttctggtcatgttcgtcattgtgacatatatgaaaatagaagaagatttttttctcag
gaacctgttgttattaacggaggttctgatttacaaaaaacatggcatcaacctaaacct
ccaactcattcccattctcatcaccatcaccatcatcatcatcatcattttcgaagttat
ccaaatcagtcattcacaaatcatcaagtacctgacaatactttagaaccttggcgttca
tattcaccgagcagggattcaaataattcaaacgaatctagtcagtgttattctgaaaca
aataacacagatcacaatcatcaggtagatgggaaaagtcatgaagacacgtcgaaaaaa
agattttcatcttatttaaaatttcatctcggtggtaaagaagaatccaagagatataat
tgtctttcgtcgtcatttaataatagtaaaagtacaagagtacagagtacctcgaatcca
agagtacagagtaccttgcaaatttcacaacctagtcaaagtccagaacctccaccgcgt
tataatcgttttacgtcacagggtgaagagagcgggtctcctttaccgatgaaaagagga
tttttagatcattcaccgttaagaaaaggtttagtcgaaggttcaccgtcgctatccaga
agatatgtatctccatcaccaccgcaaccacctcccagaagactttcagactgcaattca
gttcctggttcaccacaacatagacaagtcgaacattacagagcaagatttcattacacc
cccgaacctcaaagaagattatttaggactgaattttga

DBGET integrated database retrieval system