KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM494030Help
Entry
Phum_PHUM494030   CDS       T01223                                 

Definition
mixed-lineage leukemia 5, mll5, putative
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Phum_PHUM494030
Enzymes [BR:phu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Phum_PHUM494030
Transcription factors [BR:phu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    Phum_PHUM494030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2227 aa AA seqDB search
MVGQTRGPSRPNMAPPRNFHPISSPSSEHGRGSGAASSDSENPDSNYSVSNEGNVAEEDL
KNVVVSPENSIQKNQSCNLMNQNSTTQKSTSESSTVKIVNSDVSQYVKKMPQIANNQILS
IFPSGKSVENLKQSGDKQAESHSAGNAKRNENQPNFLTMQQKINEKLLANQIPIQRLPEQ
QFILKQVGSSDNIVTMTTAKITEPNQNYFAMLTNKPQTNYVNYLSLPVNQQNFIAVEQQQ
KNNFVVMETPPKTNFVTVPQKTNVQSSGQTYLVHGNGADLKQFNSYLAVTTKPGDTNGTT
FFTMTPTKHTSGPQTAYLMTPKQTENSRTFVAVTQKPTDATYLALPSGKNNENNKTTTFI
AMEPNKTDTNIIVTQVLPSSQQSPQLFQLEYADGDNGKSGGKYFNSRDNAVTQSIVPKLS
CNNISSSGNSTSSISTKTAIANSVPPLTSVSSSLTTKRTTVTSKALTPASVSPGKSNNIP
PLATSGSISFVSSSGNVTFLSTTNVQSLAGSTTSTLASSSPNETRYVNAESEGKGETNAS
GQEENNSSSSAAGPNVTAVPVNTVLNSNVPHSHQYLIPNVDNLKLAAESINKMMPTQNTN
SVPQGKPSNVMKVHQADQNFQMHNYSKNENSGYSNHVTKTGIQDNSRRKYGQSENNKIPG
KNVVKYSHNTYFNNQRNDKNQNHSSYKPRVEPVFDLRIPLVFQVVLTDHCYGMPMLLLRD
EKPVPVEDDKESILSSDEKGEDGEETETAAEGEDSITRCICDLEHDDGYMVCCDKCSVWQ
HVACVFPDVRVGTPLPEEYLCDVCHPRKLDRNRARALQLQRRKQIFNNSDSSDSSSSSLE
IAPRSKETGPMKKTANRRRIDSIPRKPVKLGKLDSGHNDSVVKNSIGKSRKRESNNLKSS
SVGRRTKLKRKLESRLPRAAVRRKSKNKEVIKTDKDCSSNGSSNNNNNNNNYHLKERNER
FEGGEEGNGKSPDLRTRLQILKNTNLKDLGVKGSSRTLVTSCNLSKGQLIVEIRGKFLLS
DEQPGKSDCLFFYRFPKDSSQIVVDGTGHENLARYARRSCRPNAEMKHCIVKGSLRLYLI
ASEDLSKNQEITIAHNCISDTSYTQKEGCLCKNKDCSFFLPKNSQNSATERRKRGRRRTV
SEESEGSPIKNKKENKTAAAVVVEPARRNSSITQSSRSPSSPVQQESRSDKEKDRKLTRD
ERKIEQAMKIFAQMERDTARKKDKDRPQISVTGSRKDSQMNSKGDSDKESPVESKSKRRR
RRRRRRRKVRLSSTASSTTLNQFNSGDSDLSSGDELPSPRKGSSKDSRDDELLSPIDKMS
SPRGDRNRRDSSSREKEKRHDAAGLLLALGGRYLPGQKTPTREKESENEGSPPTPLSSAC
LLVAAAVGPLAPGFRFPKTKKGLMNEWLNKSPEHPAPDFSPTPENVQLSVQSESSLPPGA
PKLSNLSNRLFNFPIDSKSLELKDPVKDSRMILDGRIPSGTPAGFGKKRWLRQAISEECD
GPQGQGSPPCPPDNVTPLKKRRLARESLSSDPPTTPPMPPSTTQTKEDRLYARDINSPES
PTIIDTESEISLAERVDALRREYLEAQERNLLKTYGRYENECTTRSERDSEEFERFNNFQ
TSPQSVPENLSYKFQDEKPPPEKSTPNANAEKPLDLTGEKEKEGSDVDVENQKVESSPKL
QKRGRGRRVGNKKGENEVRTSPRFRKSLKCRKSENGIDVKESEKGKESKEVREEEECVEN
GVSDGLKKNDSSSSSSSSKDSRSSQKTEPNVSVTVKNLDPRLRNNSVYCKSEKIPLSETK
EPEIDVVDNARDSKSDIKTESTVPFTNNSIVIKTESLNDRTCDDKEEESTESILEKLDGF
GSFKKEKKDENEGGVKGGGGEEEEEGGGDEGGAGGGSGGGVREGGGGEEGKLESVKTEGG
GPTDVKIVQNGFENVKVENKMRFTTDDDNNVNFNSKMENSFYDDKHYKNDIMVPDNLEES
QGDSKAEDLEQYSSMSDKSAPIKRKLSVTEYLNRKKCGAQGGKSSSSSSSSSSSSNPLPE
ESCGGANASPQEVMSPLASSPNDEDRSRLSSLPTPILPPVFFEMDKSLEKPGSGVRFKSE
PTELERQRENLTERLRREFGLLIADDEPKPIKMDAEDLMPPPPPPPNCPYPSYSTETSDF
IMDPIGKRSLYHPPTQTLPQSAIYPVGSSNPPNPCSFNSPYFFLPPLPPHVSHEDKRKER
KNKKFRQ
NT seq 6684 nt NT seq  +upstreamnt  +downstreamnt
atggtggggcaaacgagagggccgtcacggcccaatatggcgccgccacgtaattttcac
cccatatcatcgccgtcctcggaacacggaagaggatcgggagccgcatcatcggattcc
gaaaatcccgattcaaattattcggtgtcgaatgagggaaacgtcgcggaggaagatttg
aaaaacgttgtcgtttcaccggaaaattcaatacagaaaaatcaatcttgcaatttgatg
aatcagaattcaacgactcagaaatcgacgtcggagtcgtcgaccgttaagattgtgaat
tcggacgtttcgcaatacgttaagaagatgcctcaaatcgcgaacaatcaaatattgtca
atatttccgagtgggaaatccgttgaaaatttaaaacaatccggagacaaacaagcggag
agtcattcagccggaaatgcaaagagaaacgaaaaccagcctaattttttaacgatgcaa
cagaaaatcaacgagaagttgttggccaatcaaattccgattcaaaggttaccggagcaa
caattcatactcaaacaggttggatcttcggataatattgtgacgatgacgacggccaaa
atcacggaacccaatcaaaattactttgcaatgttgacaaacaaaccgcagacgaattat
gttaactacttgtccttacctgtcaatcaacaaaatttcattgcagtggagcaacagcaa
aaaaataattttgtagttatggaaacgccgcccaaaacgaatttcgtaacagttcctcaa
aaaacgaacgttcaatcctcgggtcaaacgtatctcgttcacggaaacggagctgattta
aaacagttcaacagttacctcgccgtcacgacgaaaccgggagacacaaatggaaccaca
tttttcacaatgactcctacgaagcacacatccggtcctcaaacggcgtatttgatgact
ccgaagcaaacggaaaacagtcgcacgtttgtcgcggtcactcaaaagccgacggatgcc
acttaccttgctctcccgtctggtaaaaacaacgaaaacaataaaacgacaactttcatc
gcgatggaacccaataaaacggacacgaatataatcgtgacgcaagttttgccatcatcc
caacaatctccacagttgtttcaattagaatacgcggacggcgacaatggaaaatccggt
gggaaatatttcaattcgagggacaatgcggtgacgcaatcgatagttcctaaattatct
tgcaacaacattagcagcagcggcaacagcaccagtagcatcagtacaaaaacggcgata
gcaaattcggtaccgccactgacaagcgtgagctcgtcgttaacgacgaaaaggacaacg
gttacgtcaaaagctttaacgccggcatccgtttctcccgggaaatcgaataatattcct
cctctggcgacttcgggaagcatttcgtttgtatcgtcctctggcaacgtaacatttttg
tctactactaacgttcagtcgttggctggttcaactacatcgacgctagctagcagttcg
cctaacgaaacccggtatgtaaatgcggaatctgaaggaaagggagaaacgaacgcttcg
ggtcaagaagagaataattcatcgtcttctgccgccggtccgaacgtaacggcagtgccc
gtgaacacggttctcaattcgaacgttcctcactcccatcaatacctgataccgaacgtc
gataatttaaaattggcggcggagagcataaataaaatgatgccgacgcaaaatactaat
tcggttccacaggggaaaccctcgaacgtaatgaaagttcatcaagcggatcaaaatttt
caaatgcacaattattccaaaaatgaaaattctggttattcaaaccacgtgaccaaaacc
ggtatacaagacaattcgagacgtaaatatggtcaaagtgaaaataataaaatcccggga
aaaaacgtggtcaaatattcgcataacacatactttaacaatcaacggaatgacaaaaat
caaaatcacagttcctataagccccgcgtggaaccggtgttcgatttgaggattccactc
gtttttcaagtggttctcacggatcattgctacggcatgcccatgttacttttgagagat
gaaaaacctgtacctgttgaagatgacaaagaaagtatactttcctccgacgagaaggga
gaagacggagaagaaacggaaacggcagcagagggagaggacagcatcacacgttgcatt
tgcgatttggaacatgatgatggatatatggtttgctgcgataagtgttccgtttggcaa
cacgtcgcttgcgtttttcccgatgtacgagtcggtacgcccttgccagaagagtacctt
tgcgacgtttgccatccgagaaaattagatagaaacagagcgagagctcttcagttgcaa
cgaagaaaacaaatattcaataattccgattcgagcgattcgagttcgagtagtttggaa
atcgctccgagatcaaaagaaacgggtcccatgaaaaaaacggccaacagacggcgaatc
gattcgataccgagaaaacctgtcaaattgggaaaattagattccggtcacaacgattcg
gtagttaaaaattcaattggtaaatctaggaaaagagaatctaataatttgaaaagttca
tccgtcggacgtcgtacgaaattaaaaagaaaactagagtctaggttgcctcgagcagcc
gtacgaagaaaaagcaaaaacaaggaagtcatcaaaacggacaaggactgcagcagtaac
ggaagcagcaacaacaacaacaacaacaacaattatcatttgaaagagagaaacgaaaga
ttcgagggtggcgaagaaggaaatggaaaatctcccgatctacgtacgagactacaaatc
cttaaaaatacaaatttgaaagatttaggagtgaagggaagttcgcggacgttggtgacg
tcgtgcaatttgtcaaagggacaattgatcgtcgaaatcagagggaaatttttactgtcg
gacgaacaacccggcaaatcggattgtttgttcttttaccgttttccaaaagatagttct
caaatcgtcgtcgacgggacgggtcacgaaaatttagcgagatatgccaggcggtcgtgt
cgtccgaatgcagagatgaagcattgcatcgtgaaaggttctctccgattgtatttgata
gcctcggaggatttgagtaaaaatcaagagataacaatagcacacaattgcataagcgat
acttcgtatactcaaaaggaggggtgcttgtgtaaaaataaggattgttcatttttttta
ccaaaaaattcacaaaattcggcaaccgaaaggaggaaaagaggtcgaagaagaacggtg
tcggaagaaagtgaaggatctccgataaagaataaaaaagaaaataaaaccgccgccgcc
gtcgtcgtcgaacccgcgagaaggaattcttcgattactcagagtagcagaagtccgagt
agtccagttcaacaggaatcccgtagcgacaaagaaaaagataggaaattgacgagagac
gaaaggaaaatcgagcaagccatgaaaatatttgctcaaatggaaagagacacggcgagg
aaaaaggataaggataggcctcaaatatcggtgacgggaagtagaaaagattcgcaaatg
aattccaaaggggattccgataaggaatcgccggttgaatcgaaatcgaaaaggagaagg
cggagacgaaggaggagaagaaaagttcgactctcatccacggcaagctcaactacactc
aatcaattcaactcaggggatagtgatttatcatctggggatgaacttcccagtcctaga
aaaggatcgtcaaaggattccagggatgatgaattactgagtcctatagataaaatgtcc
agtccgagaggtgatcgaaatcgtagggattcgagtagtcgggaaaaggaaaagagacac
gatgccgcgggtttactcttagcactcggcggacgatatcttcccggtcagaaaacaccc
acgagagaaaaagaaagtgaaaacgaaggatctcctcccactccgttatcgtctgcttgt
cttttagtagcagcagctgtcggtcctctcgctcccggttttagatttcccaaaactaaa
aagggcctaatgaacgagtggttgaataaatcaccggaacatcctgctcccgatttttcg
ccgacaccggaaaacgttcagttaagcgtacaatcggaatcctctcttccgcccggagct
ccgaaattatccaatttatcaaatcgtttgttcaattttccgatcgattcaaaatcttta
gaactcaaggacccggtaaaagattcaagaatgattctggatggaagaattccctctgga
acgccggcgggtttcggaaagaagagatggcttcgtcaggcgatatctgaagaatgcgat
ggaccgcaaggccaaggttctcctccgtgtccgccagacaacgtgacgccgttgaaaaaa
cgtcgtttagcgagagaatccttgtcgtctgatcctcctacgactcctcccatgcctccg
tcgacaactcaaacaaaggaagatcgtttgtatgcgagagacatcaatagtccggaatcg
cccacgataatcgataccgaatcggaaatttctctggccgaaagagtcgacgcactccgt
cgagaatacctcgaagctcaagaaaggaatttgttaaaaacgtacggacgatacgagaac
gagtgcacaacgagatcggaaagagacagcgaagaattcgaaaggtttaataattttcaa
acgtcacctcagagcgtgccggaaaacctcagttacaagtttcaagatgaaaaacctccg
ccggaaaagtcgactccgaacgctaacgctgaaaaaccgttggatttgacgggggagaag
gaaaaggagggaagcgacgtagatgttgaaaatcaaaaagtggaatctagtccaaaacta
caaaaaaggggaagaggtcgaagggtcggaaataaaaaaggagaaaacgaagttcggact
tctccgaggtttcgaaaaagtttaaaatgtcgtaaaagtgaaaacggcatcgatgtcaag
gaatcggaaaagggtaaagagagtaaggaagtgcgtgaggaggaggagtgcgtggaaaat
ggtgtttccgacggtcttaaaaagaacgattcgtcgtcgtcgtcgtcgtcgtcgaaagac
tcgcgatcgtctcaaaaaacggaacccaacgtttcggtgacggtgaaaaatttagatccg
agattgagaaacaattccgtgtattgcaaaagtgaaaaaatccccttgtcggagactaag
gaaccggaaatcgatgttgtggacaacgcgcgggattcaaaatccgatatcaaaaccgaa
tcgaccgttccttttaccaataattcgatagtgattaaaacggaaagtttaaatgatagg
acatgcgatgataaagaagaagaatcgacggaatcgattttggaaaaactagacggattc
gggtctttcaaaaaggaaaaaaaagatgaaaacgaaggaggagtcaaaggaggtggtgga
gaagaagaggaggaaggaggtggtgatgaaggaggagctggaggaggtagtggaggagga
gtgagagaaggaggaggaggagaagaaggaaaattggaaagcgtcaaaacggagggcgga
ggaccgacggatgtgaaaatagtacaaaacggtttcgaaaacgttaaagtcgaaaacaag
atgaggttcacgacggacgatgataataatgtaaattttaattctaaaatggagaattcc
ttttacgatgataaacattacaagaacgacattatggtgcctgataatttagaagagtct
caaggagattcaaaagcggaagatttggagcaatattcgtcaatgtccgataagagtgct
ccaatcaaaagaaagttgtccgtaacggagtacctgaatagaaaaaaatgcggagctcaa
ggtgggaaatcgtcgtcgtcgtcatcttcgtcgtcttcgtcgtcgaatccattgccggaa
gaaagttgcggcggtgcaaacgcgagtccgcaagaagtcatgtcgcctctcgcgagttct
ccaaacgacgaagacagatctcgtttgtcgtcgcttccgactcccatacttccccccgtt
tttttcgaaatggacaagagcttggagaaacccgggtccggagtccgtttcaaatccgag
cccacggaattggagcgtcagagggagaatttaacggagcgattgagacgcgaattcggt
ttgctcatagccgacgacgagccgaaacccatcaaaatggacgcggaggatttgatgccg
ccgccgccgccgccacccaattgtccgtatccgtcgtattcgacggaaacgtcggatttc
ataatggatccgatcggaaagaggagtttatatcatccgcccacgcaaacgttgccccaa
agcgccatatatcccgttggttcgagcaatcctcccaatccttgttcgttcaattctcca
tatttttttttgccgcctttgccgccccacgtttcacacgaagacaaacggaaagaaagg
aaaaataaaaaattcagacaatag

DBGET integrated database retrieval system