KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM495730Help
Entry
Phum_PHUM495730   CDS       T01223                                 

Definition
Ribokinase, putative (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Phum_PHUM495730
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Phum_PHUM495730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 312 aa AA seqDB search
MDAYDVVVVGSCMIDLICYAPRLPRNGETLYGTNFVMGFGGKGCNQCVSAKKLGANATII
ARLGNDSFGQNYFNKLKEYEISTKYISITDGTPSGMAQITVSESGENHIIIVPGANKQLN
ESDVLKATEVIETCKVLMCQLEVSENATLKALQVKSNSKKGISILNASPANIKMNPLLFT
LPDIFCVNETEAEIYTNVKINEQQHAVDAIKILLLKGCKKVIITLGEKGSVYGEKGNSNF
ICVPVLKVNAIDTTGAGDAFLGALSYFLSKHSKLDMEEMIKRANNIAALSVQKLGTQESF
PIYYEVPKHLLT
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttatgatgttgtcgttgttggctcttgtatgattgatttgatatgctacgca
ccgaggttaccaagaaatggtgaaactctatatggtactaattttgtaatgggattcggt
ggaaaagggtgcaatcaatgtgtttcagctaaaaaattgggagccaatgctacgattatt
gccaggttaggaaatgattcattcggacaaaattacttcaataagcttaaggagtatgag
atttcgacaaaatacatctcgataactgatggcacaccatctggaatggcacaaatcaca
gtttcagaatcaggtgaaaatcatattatcatagttcctggagcaaataaacaattaaat
gagtcagatgtattgaaagctactgaagtaattgaaacttgtaaagttttaatgtgtcag
ttggaagtgtccgaaaatgctacacttaaggccttacaagtcaagtcaaacagtaaaaaa
ggaatatcaattttaaatgcttctcctgctaacataaaaatgaatccactattatttaca
ctaccagatatattttgcgttaacgaaactgaagctgaaatatatacaaatgtgaaaata
aatgaacaacaacatgctgtcgatgcgattaaaattttattgctcaaaggatgtaaaaaa
gttattataactttaggagaaaaaggttcagtttatggagagaaaggaaattcaaatttc
atttgtgttccagttttgaaagtgaatgccattgatacaactggagcaggtgatgctttt
ttaggtgcattatcatattttttatcaaaacattcaaaactggacatggaagaaatgatt
aaaagagccaacaacattgctgcattgtccgttcaaaaattaggaacccaagaaagcttc
cctatatattacgaggtacccaaacatttacttacctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system