KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM500930Help
Entry
Phum_PHUM500930   CDS       T01223                                 

Definition
laminin A chain, putative
Orthology
K05635  
laminin, gamma 1
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Phum_PHUM500930
Cell adhesion molecules and their ligands [BR:phu04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      Phum_PHUM500930
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      Phum_PHUM500930
     Laminin-2 Extracellular matrix (ECM) components
      Phum_PHUM500930
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      Phum_PHUM500930
   VLA-3
      Phum_PHUM500930
     Laminin-10 Extracellular matrix (ECM) components
      Phum_PHUM500930
     Laminin-11 Extracellular matrix (ECM) components
      Phum_PHUM500930
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      Phum_PHUM500930
     Laminin-8 Extracellular matrix (ECM) components
      Phum_PHUM500930
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      Phum_PHUM500930
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      Phum_PHUM500930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1616 aa AA seqDB search
MFAFYACSFLFILLCLGFVSGQHNTTIPCYDHTGKAQRCVPEFGNAAFNVLVEATNTCGM
NGPTNYCIQTESSQKYCGFCFPPGSQEGESHPPEYLTDFNNERNQTWWQSETMLEGIQYP
NQVNLTLHLLKAYDITYVRLLFQSPRPESFVIYKRTTHDGPWIPYQYFSATCRDTYGLQQ
QVFARRGDETRAFCTSEYSDMTPLTGGSVPFSTLEGRPSAYNFDNSPELQEWVTATDIRI
TFDRLNTFGDELWKDPVVLKSYFYAVMDLAVGARCKCNGHAFECPLVGNGWERRCRCEHN
TAGPDCNECLPFYNDAPWSRATKTDAHECRACNCNGYSNRCYFDKELYEQTGHGGHCIDC
VGFRDGPNCERCKENYFQQEGGHCVACNCNEIGSRSRQCNKEGKCQCKPGVTGEKCDRCE
RNFYDFGPEGCKPCGCVVGGSLRNEPHCDPSTGTCLCKENVEGKRCQECKPGFFNLDVEN
EYGCTPCFCYGQSSVCKSTSGYSKVVIESSFARSNEKWSAADYSKHPAPVSYNGISQTIG
VQSQGHEPIYFLAPQKFLGDQRASYNQDLEFKLRIGETNAAPTVEDVMLQGAGLSISQPI
FGQNNPLPSAQVQNYKFRLHEHSDHGWQPRLSSRDFMSVLANLTAVKIRGTYFPQGVGFL
DEVKLKTARRGAAGQPANWIETCTCPSGYIGQFCESCAHKYRHEPPNGGPFARCVPCNCN
GHADSCEENTGRCICQHNTEGENCELCARGFYGNSLEGTADDCKPCPCPNKGACIQIGPG
EDNIVCLECPLGYGGPRCDLCSDGYFGDPNGKFGEAQKCQPCDCNTNVDPNAVGNCNRTT
GECLKCIYNTGGPQCDQCLPGFYGDALAIPKGDCKMCQCYRAGTMETDGGPPLCDQLTGQ
CHCKPHVQGVNCDVCEDGYFNIVSGEGCESCSCDPIGAINKTCDITTGQCMCREGIVGKR
CDMCAPYHYGFSEEGCKPCDCDLIGSSDLQCDTSGQCPCLENVEGRRCDRCKENKYDRQR
GCLNCEPCYNLVQDAANAHRVKLRELEKLLDDIANSPTVIDDADFEDKLREVQASVEALE
KEAKYGIGGGNESVLSERLSEVSSRLQHVKEMIDEVNDYRMKADVTIEHGQSNVTLAREI
VDRTREHLQQALEFVQADGFSALQRALERSDEFGQQNKQMSEISQEARHLANEHEKVAEL
IGQIAEKSENISTEAYQISKDAVKRQRNTTDELENFKSEIGRMEDRVNAIKAAAEDAQNS
ADQAQLEALGVYQEIYDLQLPEIKAEKLKEESEFLINSARKIKKEAEDLILDHTETWEEL
LKQIQESQFLLEQGEEQQNVANDLLANADVARNKAKEAVKLGEQTIKEAQDTFTILTDFE
KKVEDSKDKAQEALAMVDDIVNMIDLAANKTREAEAALQGAEKNAQIARDVAKEAQSKYA
EEASKEAHDIKREAEETKKKAGRLRDEADNLSGRVAVTESRLKKLEEKAELDEALTAEAK
KKVGQTKISVNEASKQVQKALADVNDILGELQDLSDVDENSLNDLERRLDEAEEEVLDSK
LDEMMQFLKEEKMSQSQLMGQYQDEVDRLREEVANIEKIAGSLPEGCFKRGINLEL
NT seq 4851 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgttttacgcttgttcttttttgtttattttattatgtttgggttttgtttcg
ggtcaacataacacaacgataccttgttatgatcacacgggaaaggcacagagatgcgtt
ccagaatttggtaatgctgcatttaatgtattagtcgaagcaacaaacacatgcggtatg
aacggacctacaaattattgcatacaaacggaatcaagtcaaaaatattgcggtttttgt
tttcctcccggaagtcaagagggagaatcgcatcccccggaatatttaacggatttcaat
aacgaaagaaatcaaacatggtggcaatcggaaacaatgctcgaaggaattcaatatccg
aatcaagttaatttaacattacatttacttaaagcatatgatataacttatgttcgactt
cttttccaatcgccaagaccggaaagttttgtcatatataaaagaacaacacatgatgga
ccatggattccttatcagtatttcagtgcaacgtgtagagatacgtacggtcttcagcag
caggtttttgcaaggagaggagatgaaacgagagcattttgcacttctgaatattccgac
atgacgcctttaacgggaggtagcgtgccattttcaacgttggagggtaggccgtcagca
tataatttcgataacagtccagaattgcaagaatgggtcacggccacggatataaggata
acgttcgatcgtttgaacacgttcggagatgaattatggaaagatcccgtagttttaaaa
tcgtatttttatgccgtcatggatttggctgtcggagcgaggtgtaaatgtaacggtcat
gcgttcgaatgccccttggtcggaaacggatgggaaagacgttgtaggtgcgaacataac
acagccggaccggattgcaatgaatgtttacccttttataatgatgcaccttggagcaga
gctaccaaaactgatgctcacgaatgtcgagcttgcaattgcaacggttattcaaatcgc
tgttattttgataaagagctgtacgaacaaaccggtcacggtggtcattgcattgattgc
gtgggattcagagatggtcccaattgtgaaagatgtaaagaaaattactttcagcaagaa
ggtggtcattgcgttgcgtgtaattgtaatgaaatcgggtcaagaagcagacaatgcaac
aaagagggtaaatgtcagtgtaaacctggtgtcaccggtgagaaatgcgatcgttgcgaa
cggaatttttacgatttcggacccgaaggatgtaaaccttgcggatgcgtcgtcggagga
agtttacgaaacgaaccacattgtgatccctcgaccggaacgtgtctctgtaaggaaaac
gtcgaagggaaaaggtgtcaagagtgtaaaccgggatttttcaatttggatgttgaaaat
gaatacggatgcacgccttgtttctgctacggacaatcgtccgtttgtaaatccacgtcg
ggatattcaaaagtcgtaatcgaaagttcattcgctagaagcaatgaaaaatggtcggct
gcagattattcgaaacatccggctccagtcagttacaatggaatttctcaaaccatcggc
gtgcaatctcaaggtcatgagccaatttattttctggctccgcaaaaatttttaggcgat
caaagagcgagttataatcaggatttggaattcaaacttaggattggagaaacgaacgct
gctccgacggtcgaagacgtcatgttacaaggcgcgggtttgtcaattagccaaccgata
ttcggtcaaaacaatcctcttccgtccgcccaagtgcaaaattataaatttcgtttgcac
gaacattccgatcacggatggcaacccaggttgtcttcgcgagatttcatgtccgtcttg
gcaaatttaactgccgtgaaaattaggggaacatattttcctcagggagttggattttta
gacgaagttaaattaaaaacagccagacgaggagctgcgggacaacccgcgaattggata
gaaacctgcacgtgtccctcgggttacataggacagttttgtgaaagttgcgctcataaa
tacaggcatgaaccccccaacggaggaccctttgctcgatgcgttccttgtaattgtaac
ggtcacgctgatagctgcgaggaaaatacaggaagatgtatttgtcagcacaataccgaa
ggtgaaaactgcgaattatgtgccagaggattttacggtaattctttggaaggaactgct
gatgattgtaaaccgtgtccctgtccgaacaaaggagcttgcattcaaataggtccgggt
gaagataatatcgtttgcttggagtgtcctctcggttacggtgggcccagatgcgacctg
tgcagtgacggatattttggagatcctaatggaaaattcggagaggctcaaaaatgtcaa
ccgtgtgattgtaatacgaacgtcgatcctaacgctgtaggaaactgtaacagaacaacg
ggagaatgtcttaaatgcatttacaacacggggggtccgcagtgtgaccaatgtttacct
ggtttttacggagatgccttagccattccaaaaggcgattgtaaaatgtgtcagtgctac
agagcaggtacgatggaaacggacggcggtccgccattgtgcgatcaattgaccggacaa
tgtcattgtaaacctcacgttcagggggttaattgtgacgtttgcgaagatggttatttc
aacatcgtcagtggagaaggttgcgaatcctgttcttgcgatcccatcggagcaataaac
aaaacgtgtgacataacaaccgggcaatgcatgtgtcgcgaaggaatcgtcggaaagagg
tgcgatatgtgcgctccgtatcattatggattttccgaagaagggtgcaaaccttgcgat
tgtgatttaattggaagtagcgacctacaatgtgatacttcgggtcaatgtccgtgtctc
gaaaacgttgagggtagacgttgcgatcggtgtaaggaaaacaaatacgaccgtcaaaga
ggttgtctaaattgtgagccttgctataacctggtccaagatgcagctaatgcccatcgc
gtcaaacttcgagaacttgaaaaattattagacgacattgcaaacagtccgacggtcata
gacgacgcagatttcgaagataaattaagagaagtgcaagcaagcgtcgaggctttggaa
aaggaggctaaatacggaatcggaggtggaaacgaaagcgttttatccgaaagattatcg
gaagtttcgtctcggcttcaacacgtgaaagaaatgatagatgaagtgaatgactatcgt
atgaaagcagacgtcacgatcgaacacggtcaaagcaacgtgactctcgcgagagaaata
gtcgatcgaacgcgagaacatttgcaacaagcgttggaattcgttcaagccgatggattt
tcagctcttcaaagagctctggaaagatccgacgaattcggacaacaaaacaaacaaatg
tcggaaatctcgcaagaagctcgacatttggcaaacgagcatgaaaaggtagccgaattg
attggtcagatagcggaaaaatccgaaaacatatcgacggaagcgtatcaaatatcaaag
gacgccgtgaaaaggcaaagaaacacgacggatgaattggaaaatttcaaaagcgaaatc
ggacgaatggaagatcgtgtcaatgcgataaaagccgcagcagaagacgctcaaaattct
gccgatcaggcgcaattggaagcactcggagtttaccaagaaatttacgatttgcaactt
ccggaaataaaagcggaaaagttaaaagaagaatcggaatttttaattaattcggcgagg
aaaattaaaaaagaagcagaagatttaatactcgatcatacggaaacgtgggaagaatta
ttgaaacaaattcaagaatctcagtttttactcgaacaaggagaagaacaacaaaacgtc
gccaacgatttacttgcgaatgctgacgtcgcacgaaataaagcaaaagaagccgtgaaa
ctcggtgaacaaacgataaaagaagctcaggatacttttactattttgacagatttcgaa
aagaaagtggaagattcgaaggacaaagcgcaagaagcactcgccatggtcgacgacatt
gtcaacatgattgatttagccgcgaataaaacgagagaagcggaagccgctctacaggga
gccgaaaaaaatgctcaaattgcgagagacgtggcaaaagaagcacaatcgaaatacgcc
gaagaagcatcgaaggaagctcacgacataaaacgagaagcggaagaaacgaaaaagaaa
gcaggaagattacgagacgaagctgataatttatcgggtcgcgttgccgtcacggaaagc
agattgaaaaaactcgaagaaaaagcagaattggacgaagcgttgacggcggaagcgaag
aaaaaagtcggacaaacgaaaataagcgtcaacgaagcttcgaaacaagtacaaaaagct
ctcgcggatgtcaacgacattttaggcgaactccaagatctttccgatgtcgatgaaaat
tcactcaacgatttggaaagaaggttagacgaagcagaagaagaagtattagattcgaaa
ttagatgaaatgatgcaatttttaaaagaggaaaaaatgtcgcagtctcaattaatgggc
cagtatcaagatgaagttgatagattaagagaagaagttgcaaatatagaaaaaatagca
ggttcgttgccggaaggatgtttcaaacggggtattaatttggaattgtaa

DBGET integrated database retrieval system