KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM504320Help
Entry
Phum_PHUM504320   CDS       T01223                                 

Definition
asparagine synthetase, putative (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:phu00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 562 aa AA seqDB search
MCGIWLLCGLHSYESLHRNDCFTKISHRGPDAWRLEMDSRMNNIILGFHRLSIVDGLHGM
QPMQIHKYPFLTLMCNGEIYNNKKIGEDFGFEYETKCDVECIIHLYANGGIENVVKNLDG
VFSFILIDAKEKMIHIARDPYGVRPCFMLKTNMGIFGVCSEAKGLISLEPELKGAKWEIN
PFPPGCFESYDVDDEGRLTIKLHKRYYEIGISKPGFNTFVPLQDLDAKSMKENICHLLTA
AVEKRLMSDRRIGCMLSGGLDSSLVAALLVKAAKKHNIPYKIQSFSIGMGNSPDILAARQ
VAKHIGTEHHEVIFTEEDVSKVLDKVIHTLETPDITTIRASVGMYILSKYIKEKTDSTVI
FSGEGADEIAQGYIYFRDAPDSISGHEESIRLLKDIYLFDGLRADRTTAAHCLELRLPFL
DLQFSSYYLSLPAEVRQPLNGVEKHLLRSCFENLNLIPNNILWRHKEAFSDGVTSVTKSL
FQIIQEIIDGRISDEEYNSSSSNSYNFCPPKTKEAFYYRKTFEKNYPGHCDKFMKYYWMP
KWTDVKDPSARFISHYAPENSE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggatttggcttttgtgcggtttgcattcatatgaatctttacatagaaatgat
tgttttacaaaaatatcacacagaggtccagatgcctggagattggaaatggattccaga
atgaataatataatattgggatttcatagattatcgattgtcgatggacttcacggtatg
caacctatgcaaattcacaaatatccatttttaacattgatgtgtaatggagaaatttat
aataataaaaaaatcggtgaagattttggtttcgaatatgaaacaaaatgcgatgttgaa
tgtataatacatttatatgcaaatggaggaattgaaaatgttgttaaaaatcttgatggt
gtcttttctttcatattgatagatgctaaggaaaaaatgattcacattgctcgtgatcca
tatggagtcagaccttgtttcatgcttaaaacaaatatgggaatttttggagtttgtagc
gaagcaaaaggacttatttctctggagcctgagttaaaaggtgcaaaatgggaaattaat
ccatttcctcctggttgtttcgaatcatatgatgttgatgatgaggggaggttgacgata
aaattacacaaacgttattacgaaataggaatcagcaaacctggattcaacacatttgtc
ccattacaagatttggatgcaaaaagcatgaaagaaaatatttgtcatcttttaacggct
gcagtggaaaaaagattaatgtcggatagaagaataggttgcatgttgtcaggtggtctt
gattcgagtttggtagcagcccttttggtaaaagcagctaaaaaacataatattccatac
aaaattcagtcgttttccatcggtatgggaaattctccggatattttagcagcgagacaa
gtagcaaaacatataggaaccgaacatcacgaagttattttcacggaagaagacgtatcg
aaagttttggataaagttatacacacgttggaaactccagacataacgacgatacgagcg
tcagtcggtatgtacatattatcaaaatacataaaagaaaaaacggattcgacggttatt
ttcagcggagaaggagcagacgaaatagctcagggatacatttatttccgtgacgctcca
gattccatttccggtcacgaagaaagcataagattacttaaagacatttatttattcgat
ggtcttagagcggatagaacaacggctgcacattgtttggaattacgacttccgttttta
gatcttcaattttcttcatattatttgagtcttccggcagaagtcaggcagccattgaac
ggagtagaaaaacatttgctgagaagttgttttgaaaatttaaatctcattccgaataat
attttatggcgtcacaaagaagctttcagcgatggcgtgacgtcagtgacgaaatcatta
tttcaaataatacaagaaataattgacggaagaatatcggatgaagaatataattcctcg
tcgtcgaattcatataatttttgcccaccaaaaacaaaagaagcattttattacaggaaa
acatttgaaaaaaattatccgggtcattgtgataaattcatgaaatattattggatgccg
aaatggacggatgttaaagatccatcggcgagatttatttctcattacgctcctgaaaat
tcggaataa

DBGET integrated database retrieval system