KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM514810Help
Entry
Phum_PHUM514810   CDS       T01223                                 

Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase, putative (EC:2.3.1.12 2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Phum_PHUM514810
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Phum_PHUM514810
  Amino acid metabolism
   00310 Lysine degradation
    Phum_PHUM514810
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Phum_PHUM514810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 509 aa AA seqDB search
MAGMLFFSSRSLPQNLLRAGGKAIRKSSSTQASFSYPYFPSNMCYSHSLVNLRQLRTFYR
LSDARNFCKCSSLTSVLSESFENSRREWLNCRRRIHFSPILGSDTKEVVVPPFADSVSEG
DVRWEKNVGDAVSEDETVCEIETDKTSIAVPAPGNGVIEERFVEDGTTVKAGQKLFRIKL
GGAPKAAAKPAAEAAAPPPPPPPPPPPPSDSAPPPAAKPPEAAPPPPKPAAPKSPPPKPA
APKSSTPPPPPRSIPASGATVKVPPADYSKQITGTRTEQRVKMNRMRQRIAERLKDAQNT
NAMLTTFNEIDMSNIMEFRKTNLEKFQKKYGLKLGFMSAFVKAAAYALQDQPVVNAVIDP
TGTEIIYRDYVDISVAVATPKGLVVPVIRNVESMNYPDIEIAINKLGEKARNNAIAIEDM
DGGTFTISNGGVFGSLLGTPIINPPQSSILGMHGIFDRPVARNGQVVIRPMMYVALTYDH
RLIDGREAVMFLRKIKDGVEDPRIILAGL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaatgttatttttttcttcgcggtctttaccgcaaaatttattacgggccgga
ggaaaagccattaggaaatcatctagtacacaggcaagtttttcttatccttattttcca
tccaatatgtgttattcacatagtttggtaaatctacgccagttaagaacattctaccgc
ctaagtgacgcccgaaatttttgtaaatgttcatcattaacttcagttttatccgagtca
tttgaaaattctagaagggaatggttaaattgtaggagaaggatacacttttcacctatt
ttaggtagtgatactaaagaagttgtcgttcctccatttgctgattccgtttccgaggga
gatgtgagatgggaaaaaaatgtcggtgatgcagtttcggaagatgaaacagtttgcgaa
attgaaacagacaagacatccatagcagttccagctcctggtaatggtgtaatcgaagag
cgttttgtcgaagatggtaccacagttaaagcgggacaaaaactttttagaatcaaactt
ggaggagcaccaaaagctgctgcgaaacctgctgcggaagccgcagctcctccgccgcca
cctccaccaccaccaccaccaccttctgattcagcacctccaccggctgctaagccgcca
gaagcggcgcctcctcctcccaagccagccgcaccaaaatcacctcctccaaaacctgct
gctccgaaatcttcgacaccaccacctccaccgaggtctataccagcttcaggtgcaaca
gttaaggtaccacctgcagattattcaaaacaaataacaggaaccagaacggaacaacgg
gttaaaatgaacaggatgaggcaaagaattgccgaaaggttaaaagatgcacaaaacacc
aacgccatgttaacgacttttaacgaaattgatatgagcaatataatggagtttagaaag
acaaacttagaaaaatttcaaaagaaatatggtttgaagctgggcttcatgtcggctttt
gtaaaagctgctgcttatgcacttcaagaccaaccagtcgtaaatgctgtaatcgatccg
acaggaacggaaattatttatagggattacgtcgatatttcggtcgcagtcgcgacgcca
aagggtttggttgttcccgttatacgaaacgtcgaaagcatgaattatcccgatatagaa
atcgctataaataaattgggtgaaaaagctcgtaataacgcgatagctatcgaggatatg
gacggaggtacttttaccataagcaacggaggagttttcggttctctcctcggaaccccc
ataataaatcctcctcagtcatctatattaggaatgcatgggatattcgataggcccgta
gccagaaacggacaggttgtcatacgaccaatgatgtacgtcgcattaacatacgatcat
cgtttaattgacggtcgcgaagcggtcatgttccttcgtaagataaaagacggcgtagaa
gatccgagaataatattggccggactctga

DBGET integrated database retrieval system