KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM514810Help
Entry
Phum_PHUM514810   CDS       T01223                                 

Definition
(RefSeq) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase, putative
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00020  Citrate cycle (TCA cycle)
phu00310  Lysine degradation
phu01100  Metabolic pathways
phu01200  Carbon metabolism
Module
phu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
phu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Phum_PHUM514810
  Amino acid metabolism
   00310 Lysine degradation
    Phum_PHUM514810
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Phum_PHUM514810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 PRCC IL3 GCV_H eIF3_N
Motif
Other DBs
NCBI-GeneID: 8233160
NCBI-ProteinID: XP_002431176
VectorBase: PHUM514810
UniProt: E0VYI2
AA seq 509 aa AA seqDB search
MAGMLFFSSRSLPQNLLRAGGKAIRKSSSTQASFSYPYFPSNMCYSHSLVNLRQLRTFYR
LSDARNFCKCSSLTSVLSESFENSRREWLNCRRRIHFSPILGSDTKEVVVPPFADSVSEG
DVRWEKNVGDAVSEDETVCEIETDKTSIAVPAPGNGVIEERFVEDGTTVKAGQKLFRIKL
GGAPKAAAKPAAEAAAPPPPPPPPPPPPSDSAPPPAAKPPEAAPPPPKPAAPKSPPPKPA
APKSSTPPPPPRSIPASGATVKVPPADYSKQITGTRTEQRVKMNRMRQRIAERLKDAQNT
NAMLTTFNEIDMSNIMEFRKTNLEKFQKKYGLKLGFMSAFVKAAAYALQDQPVVNAVIDP
TGTEIIYRDYVDISVAVATPKGLVVPVIRNVESMNYPDIEIAINKLGEKARNNAIAIEDM
DGGTFTISNGGVFGSLLGTPIINPPQSSILGMHGIFDRPVARNGQVVIRPMMYVALTYDH
RLIDGREAVMFLRKIKDGVEDPRIILAGL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaatgttatttttttcttcgcggtctttaccgcaaaatttattacgggccgga
ggaaaagccattaggaaatcatctagtacacaggcaagtttttcttatccttattttcca
tccaatatgtgttattcacatagtttggtaaatctacgccagttaagaacattctaccgc
ctaagtgacgcccgaaatttttgtaaatgttcatcattaacttcagttttatccgagtca
tttgaaaattctagaagggaatggttaaattgtaggagaaggatacacttttcacctatt
ttaggtagtgatactaaagaagttgtcgttcctccatttgctgattccgtttccgaggga
gatgtgagatgggaaaaaaatgtcggtgatgcagtttcggaagatgaaacagtttgcgaa
attgaaacagacaagacatccatagcagttccagctcctggtaatggtgtaatcgaagag
cgttttgtcgaagatggtaccacagttaaagcgggacaaaaactttttagaatcaaactt
ggaggagcaccaaaagctgctgcgaaacctgctgcggaagccgcagctcctccgccgcca
cctccaccaccaccaccaccaccttctgattcagcacctccaccggctgctaagccgcca
gaagcggcgcctcctcctcccaagccagccgcaccaaaatcacctcctccaaaacctgct
gctccgaaatcttcgacaccaccacctccaccgaggtctataccagcttcaggtgcaaca
gttaaggtaccacctgcagattattcaaaacaaataacaggaaccagaacggaacaacgg
gttaaaatgaacaggatgaggcaaagaattgccgaaaggttaaaagatgcacaaaacacc
aacgccatgttaacgacttttaacgaaattgatatgagcaatataatggagtttagaaag
acaaacttagaaaaatttcaaaagaaatatggtttgaagctgggcttcatgtcggctttt
gtaaaagctgctgcttatgcacttcaagaccaaccagtcgtaaatgctgtaatcgatccg
acaggaacggaaattatttatagggattacgtcgatatttcggtcgcagtcgcgacgcca
aagggtttggttgttcccgttatacgaaacgtcgaaagcatgaattatcccgatatagaa
atcgctataaataaattgggtgaaaaagctcgtaataacgcgatagctatcgaggatatg
gacggaggtacttttaccataagcaacggaggagttttcggttctctcctcggaaccccc
ataataaatcctcctcagtcatctatattaggaatgcatgggatattcgataggcccgta
gccagaaacggacaggttgtcatacgaccaatgatgtacgtcgcattaacatacgatcat
cgtttaattgacggtcgcgaagcggtcatgttccttcgtaagataaaagacggcgtagaa
gatccgagaataatattggccggactctga

DBGET integrated database retrieval system