KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM518520Help
Entry
Phum_PHUM518520   CDS       T01223                                 

Definition
TFIIH basal transcription factor complex p52 subunit, putative
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Phum_PHUM518520
  Replication and repair
   03420 Nucleotide excision repair
    Phum_PHUM518520
Transcription machinery [BR:phu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Phum_PHUM518520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 467 aa AA seqDB search
MGESSRGHRSHIQVKNLRCKYLHEYLQTLPLATLEQLYNHPTTCLAVFRELPQIARHYVS
RLLFVEQPVPQAVIASWISQTHSKEHLTATKVLTDLRVWQEAAIPGGLPGWILNSVFKKN
MKISLLGGGRPWTMSAQLEPDTKPRDIPYLDNYAMERWECVLHYMVGSQAQEGISADAVR
ILLHANLMKRDEEDGSCVITREGFQFLLLDTASQVWYFMLQYLDTVSARNLDLVECLTFL
FQLSFSTLGKDYSTIGMSEGLLVFLQHLREFGLIYQRKRRGGRFYPTRLALNIACGENKS
LQQMNKEGYIIIETNYRVYAYTDSNLQVALLGLFCEMLYRFPNLSVGLITRDSVRQAFKS
GITAEQIVGFLRLHAHPRMIAVGPPTLPPTVVDQIKLWENELNRLVYSDGVLYSQFLSQA
DFEALRDRANELGVLVWENDKKRTMVVTKSGHDDVKKFWKSYSKANS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaagtagccgaggacatcgctcgcatattcaagttaaaaatttacgttgcaaa
taccttcatgaatatcttcaaacgcttccattagcaacattagaacagctttataatcat
cccactacttgtttagcagtttttagagaattacctcaaattgcaagacactatgttagt
agattactgtttgtagaacagcctgtacctcaagcagtaatagcatcatggatatctcaa
actcattctaaagaacatttaacagcgacaaaagttttaacagatttgagagtttggcaa
gaagctgcaataccaggaggtctaccaggatggatattaaattctgtgtttaaaaaaaat
atgaaaatatcattactgggaggaggtagaccatggacaatgtcagctcaattagaaccg
gataccaaacccagagacataccatatttagataattatgcaatggagaggtgggaatgc
gttttacattatatggttggatctcaagctcaagaaggtatttctgctgatgctgttagg
atattactgcatgcaaatctcatgaaaagagacgaggaagatggttcttgcgtaataaca
agagaaggttttcaatttttactcctcgatacagcttctcaagtttggtactttatgctt
cagtatttagatactgtgagtgctagaaatttggatttagttgaatgccttacattttta
tttcaactgagttttagtacattaggaaaagattatagcacaatcggaatgagcgagggc
cttttagtttttttacaacatttaagagaattcggtttgatttatcaaaggaaaagaaga
ggaggaagattttatcctacaagattagctctcaacattgcctgcggtgaaaataaatct
ttacaacagatgaataaagaaggatatataattatagaaacaaattatagggtgtatgct
tacactgattcaaaccttcaggttgcattattgggtttattttgtgagatgctttataga
tttcctaatttatctgtcggattaattacaagagattcagttaggcaagcattcaaaagt
ggaataactgcagaacaaatcgttgggtttttaagattacatgctcatcctagaatgatt
gctgttggacctccgacacttcctccaacagtcgtcgatcaaatcaaattatgggaaaat
gaattgaacagattggtttattcagatggagttttatattctcaattcttgtctcaagct
gatttcgaagcactaagagatcgtgccaacgaattaggagtgttggtatgggaaaatgat
aaaaagcgtacaatggttgttacaaaatctggacacgacgatgttaaaaagttttggaaa
agctattcaaaagcaaacagttga

DBGET integrated database retrieval system