KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM521040Help
Entry
Phum_PHUM521040   CDS       T01223                                 

Definition
bisphosphate nucleotidase, putative
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Phum_PHUM521040
  Energy metabolism
   00920 Sulfur metabolism
    Phum_PHUM521040
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Phum_PHUM521040
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Phum_PHUM521040
    3.1.3.25  inositol-phosphate phosphatase
     Phum_PHUM521040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MNFGGKIRINKLGICIIVGAMFLFVYYMTSNKSSNLETKSVVSLKKLLIASIEATVKGGK
EVVDVYKSSKLNERSKGKTKEGVNDPITDADEKSNCAMFYSLTHTFPDIKVVSEEVSSES
DCRTLQTLDLDEQVLSSEVTMWIDPLDATKEFTENLLEYVTTMACVAVNGEPVIGVIHFP
FGEEPKTYWGWVGKGVSEELYAKFQKKLDDSHPIVIVSRSHSGQVESIVKEAFGNSFSVI
KAGGAGYKSLEVCSKNVTAYVHTSVIKKWDICAGNAIIKALGGKMTTLKNEDINYKDIKN
TVNSDGILATIENHDKLIKHFKII
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgggggcaaaattcgaataaataaacttggaatatgtattattgtgggtgct
atgtttctatttgtttattacatgacttcaaataaaagtagtaatttagaaaccaaaagt
gttgtaagtttaaaaaagttgttgatcgcctctatcgaagccactgtaaaaggtggtaaa
gaggttgtagacgtttataaaagttcaaaattaaatgaaagaagtaaagggaaaactaag
gaaggagtaaatgatcctataacggatgctgatgaaaaatctaattgtgcaatgttttat
agcttgactcatacttttccagacataaaagtggtttcagaagaagtttcatctgaatca
gattgtagaactttacaaactttagatttagatgaacaagttttatcatcggaagtaaca
atgtggattgatccattggatgctactaaagagttcactgaaaatttattagaatatgtg
actactatggcatgtgtagctgtcaatggtgaacctgtaattggagtcatacattttcct
tttggagaagaaccaaagacttattggggatgggtgggcaaaggagtatctgaagaatta
tatgccaagtttcaaaaaaaattagatgactctcatcccattgtgattgtttcaaggtca
cattctggacaagttgaaagcattgttaaagaggcatttggaaacagttttagtgtaatt
aaagccggaggagctggttacaagagtttagaagtctgtagcaaaaatgttactgcttat
gttcacacttctgttataaaaaaatgggatatatgtgcaggaaatgctataattaaagct
ttagggggtaaaatgacaacattaaaaaatgaagacattaattataaggatataaaaaac
acagttaactctgatggaatattagccactattgaaaatcatgataaacttattaaacat
tttaaaattatttag

DBGET integrated database retrieval system