KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM521040Help
Entry
Phum_PHUM521040   CDS       T01223                                 

Definition
bisphosphate nucleotidase, putative
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:phu00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:phu00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:phu04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MNFGGKIRINKLGICIIVGAMFLFVYYMTSNKSSNLETKSVVSLKKLLIASIEATVKGGK
EVVDVYKSSKLNERSKGKTKEGVNDPITDADEKSNCAMFYSLTHTFPDIKVVSEEVSSES
DCRTLQTLDLDEQVLSSEVTMWIDPLDATKEFTENLLEYVTTMACVAVNGEPVIGVIHFP
FGEEPKTYWGWVGKGVSEELYAKFQKKLDDSHPIVIVSRSHSGQVESIVKEAFGNSFSVI
KAGGAGYKSLEVCSKNVTAYVHTSVIKKWDICAGNAIIKALGGKMTTLKNEDINYKDIKN
TVNSDGILATIENHDKLIKHFKII
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgggggcaaaattcgaataaataaacttggaatatgtattattgtgggtgct
atgtttctatttgtttattacatgacttcaaataaaagtagtaatttagaaaccaaaagt
gttgtaagtttaaaaaagttgttgatcgcctctatcgaagccactgtaaaaggtggtaaa
gaggttgtagacgtttataaaagttcaaaattaaatgaaagaagtaaagggaaaactaag
gaaggagtaaatgatcctataacggatgctgatgaaaaatctaattgtgcaatgttttat
agcttgactcatacttttccagacataaaagtggtttcagaagaagtttcatctgaatca
gattgtagaactttacaaactttagatttagatgaacaagttttatcatcggaagtaaca
atgtggattgatccattggatgctactaaagagttcactgaaaatttattagaatatgtg
actactatggcatgtgtagctgtcaatggtgaacctgtaattggagtcatacattttcct
tttggagaagaaccaaagacttattggggatgggtgggcaaaggagtatctgaagaatta
tatgccaagtttcaaaaaaaattagatgactctcatcccattgtgattgtttcaaggtca
cattctggacaagttgaaagcattgttaaagaggcatttggaaacagttttagtgtaatt
aaagccggaggagctggttacaagagtttagaagtctgtagcaaaaatgttactgcttat
gttcacacttctgttataaaaaaatgggatatatgtgcaggaaatgctataattaaagct
ttagggggtaaaatgacaacattaaaaaatgaagacattaattataaggatataaaaaac
acagttaactctgatggaatattagccactattgaaaatcatgataaacttattaaacat
tttaaaattatttag

DBGET integrated database retrieval system