KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM529670Help
Entry
Phum_PHUM529670   CDS       T01223                                 

Definition
eukaryotic translation initiation factor 4E type, putative
Orthology
K03259  
translation initiation factor 4E
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Phum_PHUM529670
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Phum_PHUM529670
Translation factors [BR:phu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Phum_PHUM529670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 213 aa AA seqDB search
MPNKFDAYKSSSDDNAEEEFSAEKEALQPVVVPPGEHKLQCAYWLWFSRRTPGKTSSIQS
YDQNLKLIAKIGSVEQFWAHYSHLIRPSDLQGHSDFHLFKVGIKPMWEDEANQHGGKWIV
RLRKGLASRCWENLVLAMLGEQFMVGKEICGAVVSIRYQEDIISVWNRTASDTSTTGRIR
DTLRRVLNLPPNTIIEYKTHNDSLKYNSSFRNT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccaaataaatttgatgcttataaaagtagcagtgacgataatgcagaagaagaattt
tctgctgaaaaagaggcattgcagcctgttgttgtacctcccggtgaacacaaactacag
tgtgcatattggctgtggtttagtcgcagaactccaggaaagacttcatcaatacaaagt
tatgaccaaaatttaaaattgatcgccaaaataggttcagtggaacaattttgggcacat
tatagtcatttaattcgtccatctgatttacaaggacatagtgattttcatttatttaaa
gtcggaattaaaccaatgtgggaagatgaagctaatcaacatggtggaaaatggattgtt
agattaagaaaaggattggcttcacgctgttgggaaaatctagtgcttgctatgttagga
gaacaatttatggttggaaaagaaatatgtggagcagtagtctccattcgatatcaagaa
gatattatatcagtttggaataggacagcttcggatacctcgacgactggacgaattaga
gacactcttcgacgtgtattaaatttacctcctaacacaattatcgaatataaaactcat
aatgacagtctaaagtacaattcaagtttcaggaatacataa

DBGET integrated database retrieval system