KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM549540Help
Entry
Phum_PHUM549540   CDS       T01223                                 

Definition
Phosphoacetylglucosamine mutase, putative (EC:5.4.2.3)
Orthology
K01836  
phosphoacetylglucosamine mutase [EC:5.4.2.3]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Phum_PHUM549540
Enzymes [BR:phu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.3  phosphoacetylglucosamine mutase
     Phum_PHUM549540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 527 aa AA seqDB search
MESLIRYGTAGFRDRAENLDTVLSRVGILAVLRSKKKNGQAIGLMITASHNPECDNGVKL
IDPQGEMLEQSWEELATTLANCDDSNLSKVIEQIVESQNIDMTKPGLVLLGRDTRSSSPK
LSELAIDGIKSMNGQFKDYGIVTTPFLHYMVFCKNTFEGGKEPVVDDYNSKLVKSFKILN
DYNHGGCKNYKPFVLLDGANGVGALKVNEIKSELENLLNIKVYNSGNGKLNDKCGADYIK
VHKKAPEGVPVEINARCLAFDGDADRLVYYYIDDSKVFHLLDGDKIATLLADYLIELIRK
ANVDINLGLVQTAYANGSSTNYVKNTLKIPVACCPTGVKHLHHKALEYDVGVYFEANGHG
SVLFKKTAEDKIRNKVNSSTSSQEEKTSASRLLALIELTNQTVGDALSDALLVETVLKAK
GWNLQDWEKTYTDLPNRLLKVAVKDNTAIKTDYTEQVCLHPGELQNKINELVANVNNGRS
FIRPSGTEKVVRIYSEASTQLEADKLAMDVAKAVYELADGVGNLPTL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggagtctttaataagatatggaactgctggatttagagacagagcggaaaatttagat
acagtattatccagagttggtatattagctgttttaaggtcaaaaaagaaaaatggacaa
gcaattggtttgatgataacagcttcacataatcctgaatgtgataatggtgttaaactc
atcgatccacaaggtgaaatgttagaacaatcatgggaagaattagcgacaacattggct
aattgcgatgatagcaatcttagcaaagtgattgaacaaattgtcgaaagtcaaaatatt
gatatgactaaacctggtttagtgttgcttggaagagacacaagatcgagtagtccaaaa
ttatctgaactagccattgatggtataaaatcgatgaatggacagtttaaagattatgga
attgttacaacaccttttttacactatatggtattttgtaaaaatacattcgaaggtgga
aaagaacctgtggtggatgattacaattcaaaacttgttaaatcattcaaaatcttaaac
gattacaatcatgggggttgtaaaaactacaaaccatttgttttattagatggtgcaaat
ggtgtgggagcattgaaagttaacgaaatcaaatccgaattggaaaatcttttaaatata
aaagtgtacaacagtggaaatggaaaattaaatgataaatgtggagctgattacataaaa
gttcacaaaaaggctccagaaggagttccagttgaaatcaatgcaaggtgtttagcattc
gatggtgatgcggatcgtttggtttattattatatagatgattcgaaagtatttcattta
ctagacggtgataaaatagcaaccttgttggcggattatttaattgaattgataagaaaa
gcaaatgttgatattaatttaggattagttcaaacggcttatgccaatggaagttctaca
aattacgttaaaaatactctgaaaattcctgttgcttgttgtccaacaggtgttaaacat
ttacatcacaaagcacttgaatatgacgtaggagtttatttcgaagcaaacggtcatgga
agtgttttatttaaaaaaacagcagaagataaaattcgaaacaaagttaattcttcgaca
tcatcccaagaagagaaaactagcgcttccagacttttggctttgatcgaattgactaat
caaacggtgggagatgctctttccgatgctttattagtagaaactgtactcaaggctaaa
ggttggaatttgcaagattgggaaaaaacatacacggatttgcccaacagattgctcaaa
gttgccgttaaggacaacactgccataaaaacggattacaccgaacaggtttgcttgcat
cctggcgaattacaaaataaaataaacgaacttgttgccaacgtgaataatggccgatca
tttatcagaccttctggaactgaaaaagtcgttcgtatttattcagaagcttccactcag
ctggaagctgataaattggcaatggatgttgccaaagcagtttacgaattagcagacggc
gttggaaatcttccgacgctttaa

DBGET integrated database retrieval system