KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM561100Help
Entry
Phum_PHUM561100   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Phum_PHUM561100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1983 aa AA seqDB search
MEKSFDMWSPYKELLVTVEAVLSRPEGNVPPKFVELLKRHKQNFINLLKNPPKNAKSRDE
LKKGTTEGITLPDVGHQILSKDLVDEALILSDMYNLNEIMALDLLCIAQAQMPYHPGLTR
GLVAVILYYDGRKSLVLALHSLVAARKGFNFSSNCSEEVSDFVTAYTDELMEDGLISKLL
TLVDTLDLYKEIELLQQNRALGGPKHHKQVIDLFNSIKQNVAFTIFIWSAQCGLPKDPTL
KLIHLLKRTKIQEESTGGIDNVTLTLEMALLYALDLSILQRHEDNEEIVKKYPLLADKTF
CTTLIRELNNTSSWECKGLGALTSLAWSITLSIFKTLPQHSNDNYEDEEAAIDAAIKSKV
FKFLNRTFYENSLIYQEEFFTRRLHQLLTDFIVLMPSKVAELKKKGEESSRMTQMYAQQG
LEAPSDLSHDFEDLLLAVANLYAKDPYKLELCLEYWCPPDSQSNYRYQSRQVSLFRFVKM
SGETIPSLFFVPYLKMLCSLSNSPHSACFAYKLLRQDGQSLVSSTISWDHFFNSLSRYFS
NLRQEHPPANDTVYRHRNYPKGITPQEVQGLHSVLSVIRMVAEQDEFSRVALCENPNWSP
LTVLLGLVSCSVPILLKADLLTTLAALAKTPSTAATLWHNLEASQILTTIPSTSSYTPRG
IKTELDEIESRNEEFPLTRALLHLLDVLTDVPVPRLLGAGCRTPGFDPYLHFIIDSVFLK
FNNRSYKNPEEKWQVATSCLKLLVKFLKQYEPRSEDFFGVRVEAPGGGTTPINPPPGYHL
MISLNNKSELLRLVLHLIDEGVQRLDTYSTFPGKEALEKSNLYCLELLDVALSLQTKFLS
LVTNAGASLLLIGLSKLLLGVNPRSGKTDHMLNITKYVVYNEWLPKHSYHSVRILAFIAS
QPSTQIHLVGLFTSTPTLKIEIRHGFVECLEAEDDEENPDDEDDFGIRSKTKEIILKLLQ
QSLNLSSPNIALYLIGFDLNKDCKKMIFQQPGILQTPRTILHSLLRMLNDGIKARTGNFT
VVPKSKLLEIGYCLLYQLCSNSKTSEPILRFLRCCHDFLPRHVACLPFKPHKNSSERNQM
AWLLKIVAIELKICAANKQNSQLQNLVNLLIGDQSEEDGRSMVDEDDIVNHNAFDPRVLD
PDFSQSLNSSTSGQKRNDQRFLRILNLINFSIEYIHTPDWEFFDSSEIETILTRCEVQVN
QALKLVDVKVLHKILTDELAAIQGSSTASQRQLILNEIKDVCEYALAKNKLKTKATATLH
LMEAWRQVTEIIFAVTPNETLQNDYRQELIIDTLHILLYKVIAAENVVPEIASLSSGVIM
ILLVNLRQCQALEHRESRDSATRRNEDTGEITIMLSTLQANSNTLKNIFCGILQWIINSG
TASQKLRANLYGSLLNFLYITCVDVNEDGEEDFEDGDSLYTTRLDNSRYRLPSDSENVLR
KVILKVISHFGEGLADALCHDCTRGHDVCRMLALSCMDVLIELDPFTSWVGFLSARGYLQ
HLIDSLLESDDELVEICANDRVSTLRPLYVYESKLVLLSRIASTRDGAILLIEQNAINCL
SSMKVFDFHPKPLLPHELKIETDFVPSQSERFQQVLFPALNLFDTIVTSLGTENHSSNEA
IVHFLLCHGDTVASILRNASPRSSLGSLKEVARLTSVIARSSEIGQLEDAVQFFDVNRRH
GAHSPYLLKTLMLDLIQRFVITEELIQDIWGNSSLSSKVENPAFFESQTDEKIETILQIS
QIACNLLVHVRNAISSKDKIDYRATEPVFWPGLIDQQTIDGRSGGRGNGENPLLGHIVQQ
LTECVNYYHRESSIISQLNRKLSAVPNMTGSELQQFLPDSPMSNDMNSVKEARFSASKVI
RKRLDQKTLELEHCSFLIENCLYIIWSHLDFFMLRALPKPKQGFDFDLNKSVLASTISNK
DTSLMSVTCQDITILKNGLISIFNESFSKKLIATKEDSEKENKEFLTALLRRIKRLIQFV
PVK
NT seq 5952 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagctttgatatgtggtctccttataaagaactgcttgttaccgttgaagca
gtactttcaagacctgaaggaaatgtgcctcctaaattcgttgaacttcttaaaagacac
aagcaaaatttcatcaatttattaaaaaatccgccaaagaatgctaaaagtagagatgaa
ttaaaaaaaggcactacagaaggcattacactacctgatgtcggtcatcaaattctatca
aaagatcttgtcgatgaagccctcatactttcagatatgtataatttaaatgaaataatg
gctttagatcttttatgtatagctcaagctcagatgccatatcatccagggctaacaaga
ggcttggtcgcagttattttatattatgatggaaggaaaagcttagtcctcgcattacat
tccttagttgctgccagaaaaggctttaacttctcatcgaattgttcagaggaagtatct
gattttgttactgcttacactgatgaattaatggaagatggattaatttctaaattgtta
actttggtcgacactttggatctttataaagaaattgaattgttacagcaaaatagagct
ttaggtggcccgaaacatcataaacaagtgattgatttatttaattcaatcaaacaaaat
gtagcatttaccatttttatatggtcagctcaatgtgggttgccaaaggatccaacttta
aaattaattcacttattgaaaagaactaaaatacaagaggaatctacaggcggtattgat
aatgttactttaactctagaaatggcattgctctatgcactggatttaagtattctgcaa
agacatgaggataatgaagagattgttaaaaagtatccccttttagctgacaaaaccttt
tgtactactttaatcagagaactaaataatacttcttcttgggagtgcaaaggtttggga
gctttaactagtttagcatggagcataactctttcaatttttaaaactcttccacaacat
tcaaatgataattacgaggatgaagaagctgcaattgatgctgcgataaaatctaaagtt
tttaaatttttaaatagaacattttatgagaattcattaatataccaggaagaatttttt
accagaagacttcatcagttactaactgattttatcgttttaatgccatcaaaagttgca
gaattaaaaaaaaaaggagaagaatcatctagaatgacgcaaatgtatgcgcaacagggt
ttggaagctccttcggatctttctcatgatttcgaggatttacttcttgcagtcgcaaat
ttatatgcaaaagatccatacaaattagaattatgtttagaatattggtgtcctccagat
tctcaatctaattatagatatcagtctagacaagtatcactttttcgttttgtcaaaatg
tctggagaaactataccatcattattttttgtaccttacttaaaaatgttgtgtagcctt
tcaaattctcctcattcagcttgctttgcttacaaattattaaggcaagacggtcaatct
ttagtgagctcaacaatatcatgggatcacttctttaattctttaagccgatattttagt
aacttgcgacaggaacatcctcccgccaatgatacagtttatagacatcgtaattatcct
aaaggaatcactccacaagaagttcaaggactgcacagtgttttaagtgttattagaatg
gtagctgagcaagatgagttttcgcgggtggctttgtgcgaaaacccaaattggtctcct
ctgacggtacttttgggtttagtcagttgttcggttcctatattgttaaaagccgatctt
ttgactactttagccgccctggccaaaaccccaagtacagctgctactttatggcataat
ttggaagcttctcaaattcttactaccattcctagtactagtagttatacaccaagagga
attaagaccgaactggatgaaatagaatcaagaaatgaagaattccctttaacgagagct
cttcttcatcttttggatgttttaaccgatgtccctgttcctcgattactcggtgcaggt
tgtcgtactccaggatttgatccttatttgcattttattatagattctgtatttttaaaa
ttcaacaacaggtcttataaaaaccccgaagaaaaatggcaggtggcaactagttgccta
aaacttttggttaagtttttgaagcaatacgagccccgtagtgaagattttttcggtgtt
agagttgaagctccgggaggtggaactactccaattaatccaccaccaggataccatcta
atgataagcctgaataataaatcagagcttttgcgactggttcttcatttaattgatgaa
ggtgttcaaagactagatacgtattcgacatttcctggaaaagaagctttggagaaaagt
aatctttattgtttggaacttttagacgttgcattatctcttcaaacaaaatttttatca
ttggttacaaacgcaggagcttctttactactaataggattgtcaaaacttttactaggc
gtaaatcctagaagtggaaaaactgatcacatgcttaatattacgaaatacgttgtttac
aatgaatggctgccgaaacattcgtaccattcggtacgaattttagcatttattgcttct
caaccttctactcaaattcatctcgtcgggttgtttaccagtacaccgacattgaaaata
gaaatacgtcatggattcgtcgaatgtttagaagcggaagacgatgaggaaaatccagat
gatgaagatgactttggtataagaagcaaaaccaaagaaataattttaaaattgcttcaa
caaagtttgaatctctcatctccaaatattgctctctatttaattggattcgatttaaac
aaagattgtaaaaaaatgatttttcagcagcctggaattttacaaactccaagaactata
ttacattcgttgcttcgaatgttaaacgacggaatcaaagccagaaccggtaattttacc
gtcgttcctaaatctaagctgctcgaaatcgggtattgtttactgtatcaactatgctca
aacagtaagacctcggaaccgattttaagatttttaagatgctgccacgattttcttcct
cgacatgtggcttgtctaccttttaaacctcataaaaattcctcggagcgtaatcaaatg
gcttggctattaaaaatcgtggctatcgaattgaaaatttgcgctgctaataaacaaaat
tctcaattgcaaaatttagtaaatttacttatcggagatcaatcagaagaagatggacgt
tcaatggttgatgaagatgacatcgttaatcacaacgcatttgatccgagagttttagac
ccggatttttcacaaagtttgaattcttcgacttccggtcaaaaaaggaacgatcaaaga
tttctcagaatattaaatttaatcaatttcagtattgaatacattcatactcccgattgg
gaatttttcgattcttccgaaatagaaacaatattaactcgttgtgaggtgcaagtaaat
caagcactaaaactagtcgatgtcaaagttcttcataaaatactaacggatgagttggcg
gccattcaaggaagttccacggcttcacaacgacaattgattttaaatgaaattaaagac
gtgtgcgaatacgcattggctaaaaataaactgaaaacaaaagcaacggcgactctgcac
ttaatggaagcctggagacaagttaccgaaatcatttttgcagttactccgaacgaaact
cttcaaaacgattaccggcaagagttaattatcgatactcttcacatattactttataaa
gtgatagctgcagagaatgtagtgccggaaatagccagtttatcatcgggagttatcatg
atccttttagttaatttaagacagtgccaagctttagaacatcgggagagtagagattct
gcgacgcgacgaaatgaagacacgggagaaatcacgatcatgctttcaactctgcaagcg
aattctaacactttaaaaaatatcttttgcggaatattgcaatggataatcaattcagga
actgcttctcaaaagctaagagcaaatctatacggctcacttttgaatttcttgtatata
acgtgcgtggacgttaacgaggacggagaagaagattttgaggatggcgatagtctttac
accaccagattagataattcaagatacagacttcctagcgattctgaaaatgtattgaga
aaagttatattgaaagttatttctcacttcggtgaaggattggcggatgctctttgtcac
gattgtacaagaggtcacgacgtttgtcgaatgcttgcactttcctgcatggacgtcctg
atagaacttgatccgtttacatcgtgggtgggctttctatccgccagaggatatttacag
catttgattgacagtttgttagaatctgatgatgaattagtagagatttgtgccaacgat
cgcgtgagcactctgagacctctttacgtttacgaatcgaaattggttttgttgagcaga
atcgcttccacccgagacggcgccattttgttgattgaacaaaatgcaataaattgtcta
tcgtcgatgaaagtttttgattttcatccgaaaccccttctgcctcacgagttaaaaatc
gaaacagattttgtgccatctcaaagcgaacgctttcaacaagttttgtttccggcgtta
aatttgttcgataccatcgtcacttccctcggaaccgaaaatcattccagcaatgaagca
atagttcattttttgctctgtcacggagacaccgtcgcaagcatattaagaaacgcttcg
ccgcgatcttctttgggaagtttaaaagaagttgccaggttgacgagtgtgatagcacga
tcttcagaaataggacaactcgaggatgcggttcaatttttcgacgtcaatcgacgtcac
ggagctcattctccatatttgttgaaaactttaatgttggatttgattcaaagattcgtc
attaccgaagaattaattcaagatatctggggtaacagttcgctgtcgtccaaagtggaa
aacccggcattcttcgaatcgcaaacggatgaaaaaatagaaaccattcttcaaatatca
caaatagcgtgcaaccttttggtgcacgtgcgaaacgccatttctagcaaagataaaatc
gattacagagcaaccgagcccgtgttttggcccggtttaatagatcagcaaacaatagat
gggagaagtggggggcggggtaacggtgaaaatccattactgggacacatcgttcaacaa
ttgaccgaatgcgtgaattactatcacagagagtcatcgataataagtcaacttaataga
aaattatcggccgtacccaacatgacgggttcggaactgcaacaatttctacccgacagt
ccaatgtcgaatgatatgaattccgttaaggaggctcgtttttctgcgtccaaagtaata
agaaaacgactggatcagaaaacgttagaattggagcattgctcttttctcattgagaat
tgtttgtacatcatttggagtcatttggattttttcatgttgagagcattgccaaagccc
aaacaaggattcgatttcgatttgaataaaagtgttttagcatctacgatatcgaacaaa
gacacttctctaatgagtgtgacttgtcaagatataacaatattaaaaaatggtttaatc
agtattttcaatgaaagtttcagtaaaaaattaatagcgacaaaagaggattcggaaaaa
gaaaataaagaatttttaacggctttattaaggagaataaaaagattaatacagtttgtg
cctgtcaaataa

DBGET integrated database retrieval system