KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM561100Help
Entry
Phum_PHUM561100   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Phum_PHUM561100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1983 aa AA seqDB search
MEKSFDMWSPYKELLVTVEAVLSRPEGNVPPKFVELLKRHKQNFINLLKNPPKNAKSRDE
LKKGTTEGITLPDVGHQILSKDLVDEALILSDMYNLNEIMALDLLCIAQAQMPYHPGLTR
GLVAVILYYDGRKSLVLALHSLVAARKGFNFSSNCSEEVSDFVTAYTDELMEDGLISKLL
TLVDTLDLYKEIELLQQNRALGGPKHHKQVIDLFNSIKQNVAFTIFIWSAQCGLPKDPTL
KLIHLLKRTKIQEESTGGIDNVTLTLEMALLYALDLSILQRHEDNEEIVKKYPLLADKTF
CTTLIRELNNTSSWECKGLGALTSLAWSITLSIFKTLPQHSNDNYEDEEAAIDAAIKSKV
FKFLNRTFYENSLIYQEEFFTRRLHQLLTDFIVLMPSKVAELKKKGEESSRMTQMYAQQG
LEAPSDLSHDFEDLLLAVANLYAKDPYKLELCLEYWCPPDSQSNYRYQSRQVSLFRFVKM
SGETIPSLFFVPYLKMLCSLSNSPHSACFAYKLLRQDGQSLVSSTISWDHFFNSLSRYFS
NLRQEHPPANDTVYRHRNYPKGITPQEVQGLHSVLSVIRMVAEQDEFSRVALCENPNWSP
LTVLLGLVSCSVPILLKADLLTTLAALAKTPSTAATLWHNLEASQILTTIPSTSSYTPRG
IKTELDEIESRNEEFPLTRALLHLLDVLTDVPVPRLLGAGCRTPGFDPYLHFIIDSVFLK
FNNRSYKNPEEKWQVATSCLKLLVKFLKQYEPRSEDFFGVRVEAPGGGTTPINPPPGYHL
MISLNNKSELLRLVLHLIDEGVQRLDTYSTFPGKEALEKSNLYCLELLDVALSLQTKFLS
LVTNAGASLLLIGLSKLLLGVNPRSGKTDHMLNITKYVVYNEWLPKHSYHSVRILAFIAS
QPSTQIHLVGLFTSTPTLKIEIRHGFVECLEAEDDEENPDDEDDFGIRSKTKEIILKLLQ
QSLNLSSPNIALYLIGFDLNKDCKKMIFQQPGILQTPRTILHSLLRMLNDGIKARTGNFT
VVPKSKLLEIGYCLLYQLCSNSKTSEPILRFLRCCHDFLPRHVACLPFKPHKNSSERNQM
AWLLKIVAIELKICAANKQNSQLQNLVNLLIGDQSEEDGRSMVDEDDIVNHNAFDPRVLD
PDFSQSLNSSTSGQKRNDQRFLRILNLINFSIEYIHTPDWEFFDSSEIETILTRCEVQVN
QALKLVDVKVLHKILTDELAAIQGSSTASQRQLILNEIKDVCEYALAKNKLKTKATATLH
LMEAWRQVTEIIFAVTPNETLQNDYRQELIIDTLHILLYKVIAAENVVPEIASLSSGVIM
ILLVNLRQCQALEHRESRDSATRRNEDTGEITIMLSTLQANSNTLKNIFCGILQWIINSG
TASQKLRANLYGSLLNFLYITCVDVNEDGEEDFEDGDSLYTTRLDNSRYRLPSDSENVLR
KVILKVISHFGEGLADALCHDCTRGHDVCRMLALSCMDVLIELDPFTSWVGFLSARGYLQ
HLIDSLLESDDELVEICANDRVSTLRPLYVYESKLVLLSRIASTRDGAILLIEQNAINCL
SSMKVFDFHPKPLLPHELKIETDFVPSQSERFQQVLFPALNLFDTIVTSLGTENHSSNEA
IVHFLLCHGDTVASILRNASPRSSLGSLKEVARLTSVIARSSEIGQLEDAVQFFDVNRRH
GAHSPYLLKTLMLDLIQRFVITEELIQDIWGNSSLSSKVENPAFFESQTDEKIETILQIS
QIACNLLVHVRNAISSKDKIDYRATEPVFWPGLIDQQTIDGRSGGRGNGENPLLGHIVQQ
LTECVNYYHRESSIISQLNRKLSAVPNMTGSELQQFLPDSPMSNDMNSVKEARFSASKVI
RKRLDQKTLELEHCSFLIENCLYIIWSHLDFFMLRALPKPKQGFDFDLNKSVLASTISNK
DTSLMSVTCQDITILKNGLISIFNESFSKKLIATKEDSEKENKEFLTALLRRIKRLIQFV
PVK
NT seq 5952 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagctttgatatgtggtctccttataaagaactgcttgttaccgttgaagca
gtactttcaagacctgaaggaaatgtgcctcctaaattcgttgaacttcttaaaagacac
aagcaaaatttcatcaatttattaaaaaatccgccaaagaatgctaaaagtagagatgaa
ttaaaaaaaggcactacagaaggcattacactacctgatgtcggtcatcaaattctatca
aaagatcttgtcgatgaagccctcatactttcagatatgtataatttaaatgaaataatg
gctttagatcttttatgtatagctcaagctcagatgccatatcatccagggctaacaaga
ggcttggtcgcagttattttatattatgatggaaggaaaagcttagtcctcgcattacat
tccttagttgctgccagaaaaggctttaacttctcatcgaattgttcagaggaagtatct
gattttgttactgcttacactgatgaattaatggaagatggattaatttctaaattgtta
actttggtcgacactttggatctttataaagaaattgaattgttacagcaaaatagagct
ttaggtggcccgaaacatcataaacaagtgattgatttatttaattcaatcaaacaaaat
gtagcatttaccatttttatatggtcagctcaatgtgggttgccaaaggatccaacttta
aaattaattcacttattgaaaagaactaaaatacaagaggaatctacaggcggtattgat
aatgttactttaactctagaaatggcattgctctatgcactggatttaagtattctgcaa
agacatgaggataatgaagagattgttaaaaagtatccccttttagctgacaaaaccttt
tgtactactttaatcagagaactaaataatacttcttcttgggagtgcaaaggtttggga
gctttaactagtttagcatggagcataactctttcaatttttaaaactcttccacaacat
tcaaatgataattacgaggatgaagaagctgcaattgatgctgcgataaaatctaaagtt
tttaaatttttaaatagaacattttatgagaattcattaatataccaggaagaatttttt
accagaagacttcatcagttactaactgattttatcgttttaatgccatcaaaagttgca
gaattaaaaaaaaaaggagaagaatcatctagaatgacgcaaatgtatgcgcaacagggt
ttggaagctccttcggatctttctcatgatttcgaggatttacttcttgcagtcgcaaat
ttatatgcaaaagatccatacaaattagaattatgtttagaatattggtgtcctccagat
tctcaatctaattatagatatcagtctagacaagtatcactttttcgttttgtcaaaatg
tctggagaaactataccatcattattttttgtaccttacttaaaaatgttgtgtagcctt
tcaaattctcctcattcagcttgctttgcttacaaattattaaggcaagacggtcaatct
ttagtgagctcaacaatatcatgggatcacttctttaattctttaagccgatattttagt
aacttgcgacaggaacatcctcccgccaatgatacagtttatagacatcgtaattatcct
aaaggaatcactccacaagaagttcaaggactgcacagtgttttaagtgttattagaatg
gtagctgagcaagatgagttttcgcgggtggctttgtgcgaaaacccaaattggtctcct
ctgacggtacttttgggtttagtcagttgttcggttcctatattgttaaaagccgatctt
ttgactactttagccgccctggccaaaaccccaagtacagctgctactttatggcataat
ttggaagcttctcaaattcttactaccattcctagtactagtagttatacaccaagagga
attaagaccgaactggatgaaatagaatcaagaaatgaagaattccctttaacgagagct
cttcttcatcttttggatgttttaaccgatgtccctgttcctcgattactcggtgcaggt
tgtcgtactccaggatttgatccttatttgcattttattatagattctgtatttttaaaa
ttcaacaacaggtcttataaaaaccccgaagaaaaatggcaggtggcaactagttgccta
aaacttttggttaagtttttgaagcaatacgagccccgtagtgaagattttttcggtgtt
agagttgaagctccgggaggtggaactactccaattaatccaccaccaggataccatcta
atgataagcctgaataataaatcagagcttttgcgactggttcttcatttaattgatgaa
ggtgttcaaagactagatacgtattcgacatttcctggaaaagaagctttggagaaaagt
aatctttattgtttggaacttttagacgttgcattatctcttcaaacaaaatttttatca
ttggttacaaacgcaggagcttctttactactaataggattgtcaaaacttttactaggc
gtaaatcctagaagtggaaaaactgatcacatgcttaatattacgaaatacgttgtttac
aatgaatggctgccgaaacattcgtaccattcggtacgaattttagcatttattgcttct
caaccttctactcaaattcatctcgtcgggttgtttaccagtacaccgacattgaaaata
gaaatacgtcatggattcgtcgaatgtttagaagcggaagacgatgaggaaaatccagat
gatgaagatgactttggtataagaagcaaaaccaaagaaataattttaaaattgcttcaa
caaagtttgaatctctcatctccaaatattgctctctatttaattggattcgatttaaac
aaagattgtaaaaaaatgatttttcagcagcctggaattttacaaactccaagaactata
ttacattcgttgcttcgaatgttaaacgacggaatcaaagccagaaccggtaattttacc
gtcgttcctaaatctaagctgctcgaaatcgggtattgtttactgtatcaactatgctca
aacagtaagacctcggaaccgattttaagatttttaagatgctgccacgattttcttcct
cgacatgtggcttgtctaccttttaaacctcataaaaattcctcggagcgtaatcaaatg
gcttggctattaaaaatcgtggctatcgaattgaaaatttgcgctgctaataaacaaaat
tctcaattgcaaaatttagtaaatttacttatcggagatcaatcagaagaagatggacgt
tcaatggttgatgaagatgacatcgttaatcacaacgcatttgatccgagagttttagac
ccggatttttcacaaagtttgaattcttcgacttccggtcaaaaaaggaacgatcaaaga
tttctcagaatattaaatttaatcaatttcagtattgaatacattcatactcccgattgg
gaatttttcgattcttccgaaatagaaacaatattaactcgttgtgaggtgcaagtaaat
caagcactaaaactagtcgatgtcaaagttcttcataaaatactaacggatgagttggcg
gccattcaaggaagttccacggcttcacaacgacaattgattttaaatgaaattaaagac
gtgtgcgaatacgcattggctaaaaataaactgaaaacaaaagcaacggcgactctgcac
ttaatggaagcctggagacaagttaccgaaatcatttttgcagttactccgaacgaaact
cttcaaaacgattaccggcaagagttaattatcgatactcttcacatattactttataaa
gtgatagctgcagagaatgtagtgccggaaatagccagtttatcatcgggagttatcatg
atccttttagttaatttaagacagtgccaagctttagaacatcgggagagtagagattct
gcgacgcgacgaaatgaagacacgggagaaatcacgatcatgctttcaactctgcaagcg
aattctaacactttaaaaaatatcttttgcggaatattgcaatggataatcaattcagga
actgcttctcaaaagctaagagcaaatctatacggctcacttttgaatttcttgtatata
acgtgcgtggacgttaacgaggacggagaagaagattttgaggatggcgatagtctttac
accaccagattagataattcaagatacagacttcctagcgattctgaaaatgtattgaga
aaagttatattgaaagttatttctcacttcggtgaaggattggcggatgctctttgtcac
gattgtacaagaggtcacgacgtttgtcgaatgcttgcactttcctgcatggacgtcctg
atagaacttgatccgtttacatcgtgggtgggctttctatccgccagaggatatttacag
catttgattgacagtttgttagaatctgatgatgaattagtagagatttgtgccaacgat
cgcgtgagcactctgagacctctttacgtttacgaatcgaaattggttttgttgagcaga
atcgcttccacccgagacggcgccattttgttgattgaacaaaatgcaataaattgtcta
tcgtcgatgaaagtttttgattttcatccgaaaccccttctgcctcacgagttaaaaatc
gaaacagattttgtgccatctcaaagcgaacgctttcaacaagttttgtttccggcgtta
aatttgttcgataccatcgtcacttccctcggaaccgaaaatcattccagcaatgaagca
atagttcattttttgctctgtcacggagacaccgtcgcaagcatattaagaaacgcttcg
ccgcgatcttctttgggaagtttaaaagaagttgccaggttgacgagtgtgatagcacga
tcttcagaaataggacaactcgaggatgcggttcaatttttcgacgtcaatcgacgtcac
ggagctcattctccatatttgttgaaaactttaatgttggatttgattcaaagattcgtc
attaccgaagaattaattcaagatatctggggtaacagttcgctgtcgtccaaagtggaa
aacccggcattcttcgaatcgcaaacggatgaaaaaatagaaaccattcttcaaatatca
caaatagcgtgcaaccttttggtgcacgtgcgaaacgccatttctagcaaagataaaatc
gattacagagcaaccgagcccgtgttttggcccggtttaatagatcagcaaacaatagat
gggagaagtggggggcggggtaacggtgaaaatccattactgggacacatcgttcaacaa
ttgaccgaatgcgtgaattactatcacagagagtcatcgataataagtcaacttaataga
aaattatcggccgtacccaacatgacgggttcggaactgcaacaatttctacccgacagt
ccaatgtcgaatgatatgaattccgttaaggaggctcgtttttctgcgtccaaagtaata
agaaaacgactggatcagaaaacgttagaattggagcattgctcttttctcattgagaat
tgtttgtacatcatttggagtcatttggattttttcatgttgagagcattgccaaagccc
aaacaaggattcgatttcgatttgaataaaagtgttttagcatctacgatatcgaacaaa
gacacttctctaatgagtgtgacttgtcaagatataacaatattaaaaaatggtttaatc
agtattttcaatgaaagtttcagtaaaaaattaatagcgacaaaagaggattcggaaaaa
gaaaataaagaatttttaacggctttattaaggagaataaaaagattaatacagtttgtg
cctgtcaaataa

DBGET integrated database retrieval system