KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM563940Help
Entry
Phum_PHUM563940   CDS       T01223                                 

Definition
(RefSeq) Lysozyme P precursor, putative
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Phum_PHUM563940
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM563940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys SLT
Motif
Other DBs
NCBI-GeneID: 8234767
NCBI-ProteinID: XP_002431986
VectorBase: PHUM563940
UniProt: E0W0U2
AA seq 195 aa AA seqDB search
MSNVQTMFPLYGITLFILTFSFVSGKVYDRCELARELKYVHEAPSEQLATWVCIAEHESQ
YKTDAVGRLGEKGSADHGIFQISDKYWCSPDRKGCGLTCDELEDDDISNDFKCSLKIHKE
HTGISGDGFNAWVVYKSLCKGYKAKKYLRGCFNDTNDNNVYSSTVTSSSPYPGFEGQNNT
RDLNSAEKFRVLRVR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgttcaaacaatgtttccgttgtacggtataacattattcattttaacgttt
tcgttcgtttcgggtaaagtttacgacagatgcgaacttgcaagagaattaaaatacgtt
cacgaagcaccatccgaacaattggctacctgggtttgcattgccgaacacgaatcacaa
tataaaacggatgcggtaggtcgtttgggtgaaaagggttcagccgatcacggaattttt
cagataagtgataaatattggtgttcgccagatagaaagggatgcggtttaacttgcgat
gaattagaagatgacgatatatcgaacgattttaaatgttcgttaaaaatacataaagaa
catactggaatttctggtgatggtttcaacgcgtgggtcgtttacaaatccctttgcaaa
ggttacaaagctaaaaaatatttgagaggatgttttaacgatacaaacgataacaacgta
tattcctcgacggtaacttcttcgtcgccgtatccgggattcgagggacaaaacaatacc
cgagatttgaattcagcggaaaaatttcgagtccttcgagttcgataa

DBGET integrated database retrieval system