KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM563940Help
Entry
Phum_PHUM563940   CDS       T01223                                 

Definition
Lysozyme P precursor, putative (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Phum_PHUM563940
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM563940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 195 aa AA seqDB search
MSNVQTMFPLYGITLFILTFSFVSGKVYDRCELARELKYVHEAPSEQLATWVCIAEHESQ
YKTDAVGRLGEKGSADHGIFQISDKYWCSPDRKGCGLTCDELEDDDISNDFKCSLKIHKE
HTGISGDGFNAWVVYKSLCKGYKAKKYLRGCFNDTNDNNVYSSTVTSSSPYPGFEGQNNT
RDLNSAEKFRVLRVR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgttcaaacaatgtttccgttgtacggtataacattattcattttaacgttt
tcgttcgtttcgggtaaagtttacgacagatgcgaacttgcaagagaattaaaatacgtt
cacgaagcaccatccgaacaattggctacctgggtttgcattgccgaacacgaatcacaa
tataaaacggatgcggtaggtcgtttgggtgaaaagggttcagccgatcacggaattttt
cagataagtgataaatattggtgttcgccagatagaaagggatgcggtttaacttgcgat
gaattagaagatgacgatatatcgaacgattttaaatgttcgttaaaaatacataaagaa
catactggaatttctggtgatggtttcaacgcgtgggtcgtttacaaatccctttgcaaa
ggttacaaagctaaaaaatatttgagaggatgttttaacgatacaaacgataacaacgta
tattcctcgacggtaacttcttcgtcgccgtatccgggattcgagggacaaaacaatacc
cgagatttgaattcagcggaaaaatttcgagtccttcgagttcgataa

DBGET integrated database retrieval system