KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM565420Help
Entry
Phum_PHUM565420   CDS       T01223                                 

Definition
DNA repair and recombination protein RAD54B, putative (EC:2.7.11.1)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:phu03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 840 aa AA seqDB search
MRKSQAPSFKTNTSPIRRNIISFNKNNNPPDSNDKSKRSTESVLDLLLNLDSTSVKSKND
FFEDDSFKNSNINTNTLDVVEQNKITDSNSICIPENSEQCEIVYNVVYGKQTKKKHKTWE
GDGILEVGSKYVTLKDENGVVIGKAQCSKARKLEEGVRFCIGSKEVELLDLVETKDRKKK
NLSIKENNEKVIPQLPKILKSNNSNKKFKTPRSCFEAGIPLPNPTTEHQWHFNQSGAKVT
PVYIEESLSKKLRQHQLEGIIFLYESIMGYKDINYNGVILADEMGLGKTLQCISLIWTLL
KQGPYNKKPVIKRVLIVTPTSLIMNWYNEFIKWLGRVKIVPYVVNQKNKPSEIKYHSVVI
ISYEMLIRCVNNVMEHNVDLLVCDEAHRIKNSNIKTAQVLNQLNCKKKILLTGTPLQNDL
QELYTLIDFANPNILGSPSQFRIQFADPIIASRQPDSNEDVVKKGNERSINLKKIINKFL
LRRTRNILKNYLPPRHDIVVFCKITEPQRNMYNSLVNSFLNAKESEEFIEGSSHLELITS
LKKICNYPSLLNKDDNYLEKIDIDTSGKLKVTVNFLKELQMTSVKEKVLIVSNATQTLNL
LEKVFHVLNYSTCRLDGNTPSAQRNKIVEDFNTSRDLFIFLLSSKAGGVGLNVTGASRLI
LFDSDWNPATDLQAISRIWRDGQKFPVFIYRLLTTGTIEEKIYQRQISKQGLCEGTVDPK
SNKSIKLSKEELKELFFPCEEKDIKDCLTHDSLSCDCTGQGEIPAPNNGGEEEEEEEEDD
GDDENKSCRIYNKTIKSALKISELFHWEHHGNPFDSDFLNRLCLEKSKQRISYIFHNRKI
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaatctcaagcaccttcatttaaaacaaacacttcgccgatacgtagaaatata
attagttttaataaaaataataatcctccagattcaaatgataaaagcaaacgaagtacc
gaaagcgtgcttgatttactgttaaatttagattctacttccgttaaaagtaaaaacgat
ttttttgaagatgatagttttaaaaactctaatattaataccaatactttagatgtagta
gaacaaaataaaataactgattctaactcgatatgcatacctgaaaatagtgagcagtgt
gaaattgtatataatgtagtttatggaaagcaaacgaaaaaaaaacataaaacttgggaa
ggtgatggtattttagaagtcggatcaaagtatgttacacttaaagatgaaaatggggtt
gttattggtaaagcacaatgtagtaaagctcgaaaacttgaagaaggtgtaagattttgc
attggcagcaaggaagtcgagttgttagatttagttgaaactaaagatcgtaaaaaaaaa
aatttatcgataaaagaaaataatgaaaaagttattccacaacttcctaaaatccttaaa
tctaacaattctaataaaaaatttaaaactcccagatcatgttttgaagctggtatacct
ttacccaatcccactaccgaacatcagtggcattttaaccagtcaggtgcaaaggtgact
ccagtgtatatagaagaatcattatcgaaaaaattacgacaacatcaacttgaaggaata
atttttttatatgaatccattatgggatacaaagatattaattataatggagtaatatta
gctgatgaaatgggccttggaaaaactcttcaatgcatttcattaatttggactttgctt
aaacaaggaccttacaataaaaaacctgtgataaaaagagttttaatcgttacacccaca
agtttgattatgaattggtacaatgaatttatcaaatggcttggaagagttaaaatagtt
ccttatgttgttaatcaaaaaaataaaccatctgaaataaaatatcactctgttgtgatt
atttcatatgaaatgttaatcaggtgcgtgaataacgtgatggagcacaacgtagattta
ttagtgtgtgatgaagctcacaggataaaaaattcaaatataaaaacggctcaagtactt
aatcaattaaattgtaaaaaaaaaattctattaactggaactccgctacaaaacgacctt
caagaattgtacactcttatagattttgccaatccgaatattttagggagtccatcgcaa
tttcgaattcaatttgcagatccgataatagcctctcgtcaacccgattcgaacgaagac
gttgttaaaaagggaaacgaacgttctattaatttaaaaaaaataattaacaaattttta
ttgagacgaactcgaaacatattaaaaaattatttacctcccagacatgacattgtagtt
ttttgtaagattacagaacctcaaagaaatatgtataattcattggtaaattcattttta
aacgctaaggaaagtgaagaatttattgaaggatcgtctcatcttgaacttataacatca
ttaaaaaaaatttgtaattatccgtcattactgaataaagacgataattacttggagaaa
atcgatatcgacacgagcggaaaattaaaagtaaccgttaattttttaaaagaattacaa
atgacgtcagtcaaagaaaaagttttaatcgtttcaaatgcaacacaaactttaaactta
ttggaaaaagtttttcacgttctcaattactctacgtgtcgtttggatggtaacacgccg
tcagcacaaagaaataaaatcgtagaagattttaatacgtcacgtgacttatttattttt
ctattgagctcaaaagctggaggagtcggtttaaatgtcaccggcgcttccaggctcata
ctattcgattcagactggaatccagcaactgatcttcaagcgatttccagaatatggaga
gacggtcaaaagtttcccgtttttatatacaggcttttgacgactggaacaatagaagaa
aaaatttatcagcgtcaaataagcaaacaaggtctttgcgagggtacagtcgatccaaaa
agtaataaatcaataaaattatctaaagaagaattaaaagaactttttttcccatgcgaa
gagaaagatattaaagattgcttaacgcacgattcattgtcgtgcgattgtacaggacaa
ggagaaattccagctcccaataacggtggagaagaagaagaagaggaagaagaggatgat
ggtgatgacgaaaacaaaagttgtcgaatttataataaaacaatcaaatccgcgttgaaa
atatcagaattatttcattgggaacatcatgggaatcccttcgattcggattttttaaat
cgtttatgtttggaaaaaagcaaacaacgtatatcatacatatttcacaatcgtaaaata
taa

DBGET integrated database retrieval system