KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM566810Help
Entry
Phum_PHUM566810   CDS       T01223                                 

Definition
Palmitoyl-protein thioesterase 1 precursor, putative (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Phum_PHUM566810
  Lipid metabolism
   00062 Fatty acid elongation
    Phum_PHUM566810
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Phum_PHUM566810
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Phum_PHUM566810
Lipid biosynthesis proteins [BR:phu01004]
 Fatty acid synthase
  Component type
   Phum_PHUM566810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 331 aa AA seqDB search
MNFFINNFNFLRCFLLFLCILPFSTAIYPIVLWHGMGDSCCSSGSMGYIAELIKKVFPKV
KILSLKFGHNEFDEKYNSYFMNVNDQVKFACELLKNDSRMKNGYNAIGFSQGAQFLRAVV
QRCPDPPMKNLISVGGQHQGVYGLPKCSESFSFCNDIRKLLNTLAYTDYVQKSLVQAQYW
HDPLNEDLYRHHSTFIADINNEKDFINETYIENLNKLERLILVLFERDSLVTPKESSWFG
FYSPGQSQKVIPLDETNLFKKNLIGLKQLIEADKIHFESVNGDHLQFSSEWFMNLVREYL
SEDNPTLNISKNHTLFSRIKLKNNTNKNYDN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttttattaataattttaattttttacgttgtttcttgttgtttttatgcatt
ttacctttctctacagccatttatccaattgttctttggcacggaatgggtgacagttgt
tgttcgtctggtagtatgggatacattgctgaattaataaaaaaagtatttccaaaagta
aaaattctttcgcttaaattcggtcacaatgaatttgatgaaaaatataattcttatttt
atgaatgtcaatgatcaagtaaaatttgcatgcgaacttctgaaaaatgattcgagaatg
aaaaatggttataatgcgataggattttctcaaggagcacaattcctgagagcagttgtt
cagagatgtcctgatcctccaatgaaaaatttaatatcagtcggtggacaacatcaggga
gtttacggtttaccaaaatgttccgaatcgtttagtttttgcaatgatattagaaaatta
ttaaatactttagcttacactgattatgttcaaaaaagtttagttcaagctcaatattgg
catgatccactcaatgaagatctttacaggcatcattcaacgtttatagccgatataaat
aatgaaaaggatttcattaatgaaacctacatagaaaatttaaacaaattagaaagattg
attttagttttattcgaaagagatagtttggtgactccgaaagaatcatcatggtttgga
ttttattctccaggacaatcacaaaaagtaataccattggacgaaacaaatcttttcaaa
aagaatttgatcgggttaaaacaattaatagaagctgataaaatacattttgaatctgtc
aatggagatcatttacaattttcatcggaatggtttatgaatcttgtaagggaatattta
tcggaagataatccaacattaaacatatctaaaaatcatactttattttctcgaataaaa
ttaaaaaataatacaaataaaaattatgataattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system