KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM570660Help
Entry
Phum_PHUM570660   CDS       T01223                                 

Definition
serine/threonine-protein phosphatase PP-V, putative (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Phum_PHUM570660
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Phum_PHUM570660
Protein phosphatases and associated proteins [BR:phu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Phum_PHUM570660
Transcription machinery [BR:phu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Phum_PHUM570660
Messenger RNA biogenesis [BR:phu03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     Phum_PHUM570660
Spliceosome [BR:phu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Phum_PHUM570660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 322 aa AA seqDB search
MTEIELNVDHLIARLLEVRGCRPGKIVQMSESEVRSLCLKSREIFLQQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRYNIKLWKIFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ
GMEQIRRIMRPTDVPDTGLLCDLLWSDPEKDVQGWGENDRGVSFTFGADVVAKFLNKHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYTGMNSGRPGTGAGKRK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatagagctaaatgtagatcatttgattgctcgtttattagaagtaagagga
tgccgccctggaaaaattgtacagatgtcggagtcggaagttcgaagcctttgtttaaaa
tctagagaaatatttttacaacaaccgatattattagaacttgaagctccattaaaaata
tgtggtgacattcatggacaatatacggatctcctcagattattcgaatatggcggtttt
cctcccgatgcaaattatttatttctcggagattatgttgatcgtggcaaacaaagttta
gaaacaatttgtttacttttggcatataaaataaaatatccagaaaatttctttttacta
agaggaaatcacgagtgcgccagtattaatagaatatatggattttacgatgaatgtaaa
cgccgatataatattaaattatggaagatatttactgattgttttaattgtttaccaata
gcagccattattgatgagaaaatattttgttgtcatggcggtttatcacccgatttacaa
ggaatggaacaaatcagaagaataatgagacccactgacgtacccgatactggtttactt
tgtgatttactatggtctgacccggaaaaagatgtacaaggttggggagaaaatgatcgc
ggagtttcattcacgttcggagctgatgtcgtagcaaaatttttaaataaacacgatttg
gatttgatatgcagagctcaccaggtcgtggaagacggttatgaattttttgctaaaaga
caattggttacgttattttcggcgccaaattattgcggagaatttgataacgccggaggt
atgatgtcggtcgatgaaacgctcatgtgttcctttcagatattgaaaccgtctgaaaag
aaagccaagtatcagtatacgggaatgaattcgggtcgacctggaacgggagcgggaaag
agaaaataa

DBGET integrated database retrieval system