KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM574180Help
Entry
Phum_PHUM574180   CDS       T01223                                 

Definition
pyruvate dehydrogenase kinase, putative (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 427 aa AA seqDB search
MTNWTKNLTKLLDFYSQFTPTPLSIKHFLEFGLAACERKSFLFLRQELPVRLSNIMKEIH
LLPQNLLKMPSVALVNEWYAQSFEEILEFEKSDINDKVLNRFCESLVRIRNRHYDTVQTM
AQGVLELKELHKVDQQTENSIQYFLDRFYMSRISIRMLINQHTLLFDKNVEGEKSKLSSR
HVGCIDPACDLRNVVEDAYENAKFLCDQYYMASPELIVYEHNTSMSKERIKIVYVPSHLY
HMLFELFKNSMRAIMEHHNSSSENFSPITVTIVKGKEDVCIKMSDMGGGIPRSETEHLFK
YMYSTAPRPSGGDHSSAPLAGYGYGLPISRLYAKYFHGDLHLLSCDGYGTDTIIYLKLLA
NEANELLPIFNKTSSKFYQATIPAGDWSNQSSFITAKNQSLSSKKINNFKNDTTINNDSK
IKINSKT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgactaattggacaaaaaatcttaccaaacttttagatttttactctcaatttacgcca
actcctttgtctataaaacattttcttgagtttggtttagcagcatgtgagcgtaaatca
ttcctttttttaaggcaggaacttccagtacgcctttcaaatatcatgaaagaaattcat
cttttaccacaaaatttattaaaaatgccttctgtggcacttgtcaacgaatggtatgct
caatcatttgaagaaatattagaatttgaaaaatctgacattaatgataaagttttaaat
agattttgtgaatcattagtaaggattcgtaatcgtcattatgatactgttcaaactatg
gctcaaggtgttttggaactaaaagaattacataaagtagatcaacagacagaaaattca
atacagtattttttagatagattttatatgtctcgaatcagcattcgtatgttaatcaat
caacacacattattatttgataaaaatgtagagggagaaaaaagtaaattatcatctcgt
catgttggttgcattgatccagcttgcgatttgagaaatgttgttgaagatgcttatgaa
aatgctaaatttttatgtgatcaatactatatggctagtcctgagttaatagtttatgaa
cacaacacttccatgtcaaaagaaaggataaaaattgtatatgttccaagtcatctatat
cacatgctatttgaattgtttaaaaattcaatgagagcaataatggagcatcacaacagc
tcatctgaaaatttttcacccataacagttaccatagtaaagggtaaagaagatgtgtgt
attaaaatgtcagatatgggaggtggtatcccacgctctgaaacagagcatttatttaaa
tatatgtattcaactgcacctagaccaagtgggggtgatcatagctcagcaccattggca
ggatatggatatggtttaccaatatctaggttgtatgcaaaatattttcatggggattta
catcttctttcctgtgatgggtatggtacagacactataatttatttaaaactcttagct
aatgaagctaatgaattacttcccatttttaataaaacttcgtcaaaattttatcaagcc
acaataccagctggagattggtcaaatcagtctagtttcataacagctaaaaaccaatct
ctttcatccaaaaaaataaataattttaaaaatgacacaacaataaataatgattcaaaa
ataaaaattaattcaaaaacttga

DBGET integrated database retrieval system