KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM574420Help
Entry
Phum_PHUM574420   CDS       T01223                                 

Definition
(RefSeq) Dihydrofolate reductase, putative
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00670  One carbon pool by folate
phu00790  Folate biosynthesis
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Phum_PHUM574420
   00670 One carbon pool by folate
    Phum_PHUM574420
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Phum_PHUM574420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 8234948
NCBI-ProteinID: XP_002432166
VectorBase: PHUM574420
UniProt: E0W1C2
AA seq 190 aa AA seqDB search
MVNNFNLIAAVCSNNGIGYKGNLPWNLRKELQYFNRMTKDVKNPEKKNAVIMGRKTWDSL
PHNWKPLPGRYNFVLTTQSLNLDGAVVCSDLNDLIKKINSPDYSNLIETAWVIGGSKVYE
SVLKYGLCHRFYLTRIKKEFECDCFFNYDFTKDFKEVSDDRVPKGVQKENEIEYVFHVYE
KVNESKDSSN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacaattttaatttgatagccgccgtttgtagcaataatggtatcggatataag
ggaaatcttccatggaatttaagaaaggaattgcagtattttaatagaatgacaaaagat
gttaaaaatccagagaaaaaaaatgcagtcattatgggtcgtaaaacttgggattcttta
ccacacaattggaaaccattacctggaagatataattttgttttgactactcagtcatta
aatttagatggagcagttgtttgttccgatttaaatgatttaataaaaaaaataaattct
cctgattattctaacctaatagaaacagcttgggtgataggaggttcaaaagtttatgaa
agcgttttaaaatatggactttgtcataggttttatctaactcgaataaaaaaagaattt
gaatgtgattgtttttttaattatgattttaccaaagattttaaagaagtcagtgatgat
agagttcctaaaggagttcaaaaagaaaatgaaatagaatatgtttttcacgtttatgaa
aaagtaaatgaatcaaaggacagttctaactga

DBGET integrated database retrieval system