KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM574420Help
Entry
Phum_PHUM574420   CDS       T01223                                 

Definition
Dihydrofolate reductase, putative (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:phu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:phu00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 190 aa AA seqDB search
MVNNFNLIAAVCSNNGIGYKGNLPWNLRKELQYFNRMTKDVKNPEKKNAVIMGRKTWDSL
PHNWKPLPGRYNFVLTTQSLNLDGAVVCSDLNDLIKKINSPDYSNLIETAWVIGGSKVYE
SVLKYGLCHRFYLTRIKKEFECDCFFNYDFTKDFKEVSDDRVPKGVQKENEIEYVFHVYE
KVNESKDSSN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacaattttaatttgatagccgccgtttgtagcaataatggtatcggatataag
ggaaatcttccatggaatttaagaaaggaattgcagtattttaatagaatgacaaaagat
gttaaaaatccagagaaaaaaaatgcagtcattatgggtcgtaaaacttgggattcttta
ccacacaattggaaaccattacctggaagatataattttgttttgactactcagtcatta
aatttagatggagcagttgtttgttccgatttaaatgatttaataaaaaaaataaattct
cctgattattctaacctaatagaaacagcttgggtgataggaggttcaaaagtttatgaa
agcgttttaaaatatggactttgtcataggttttatctaactcgaataaaaaaagaattt
gaatgtgattgtttttttaattatgattttaccaaagattttaaagaagtcagtgatgat
agagttcctaaaggagttcaaaaagaaaatgaaatagaatatgtttttcacgtttatgaa
aaagtaaatgaatcaaaggacagttctaactga

DBGET integrated database retrieval system