KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM574420Help
Entry
Phum_PHUM574420   CDS       T01223                                 

Definition
Dihydrofolate reductase, putative (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Phum_PHUM574420
   00670 One carbon pool by folate
    Phum_PHUM574420
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Phum_PHUM574420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 190 aa AA seqDB search
MVNNFNLIAAVCSNNGIGYKGNLPWNLRKELQYFNRMTKDVKNPEKKNAVIMGRKTWDSL
PHNWKPLPGRYNFVLTTQSLNLDGAVVCSDLNDLIKKINSPDYSNLIETAWVIGGSKVYE
SVLKYGLCHRFYLTRIKKEFECDCFFNYDFTKDFKEVSDDRVPKGVQKENEIEYVFHVYE
KVNESKDSSN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacaattttaatttgatagccgccgtttgtagcaataatggtatcggatataag
ggaaatcttccatggaatttaagaaaggaattgcagtattttaatagaatgacaaaagat
gttaaaaatccagagaaaaaaaatgcagtcattatgggtcgtaaaacttgggattcttta
ccacacaattggaaaccattacctggaagatataattttgttttgactactcagtcatta
aatttagatggagcagttgtttgttccgatttaaatgatttaataaaaaaaataaattct
cctgattattctaacctaatagaaacagcttgggtgataggaggttcaaaagtttatgaa
agcgttttaaaatatggactttgtcataggttttatctaactcgaataaaaaaagaattt
gaatgtgattgtttttttaattatgattttaccaaagattttaaagaagtcagtgatgat
agagttcctaaaggagttcaaaaagaaaatgaaatagaatatgtttttcacgtttatgaa
aaagtaaatgaatcaaaggacagttctaactga

DBGET integrated database retrieval system