KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM580220Help
Entry
Phum_PHUM580220   CDS       T01223                                 

Definition
dual specificity protein kinase CLK2, putative (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Phum_PHUM580220
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Phum_PHUM580220
Spliceosome [BR:phu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Phum_PHUM580220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 401 aa AA seqDB search
MISPWRSNVTGARCVPVTSSLSFSNGEWRYPRQTSREREREPTIEDDEDGHLIYRIGDVL
TNKWKIVASLGEGTFGKVLQVKDVDNPDNVIALKVIRNVGKYREAAKLEINALQKIAEKD
PDGKYLTVKMLCYFDLSGHVCIGFEMLGLSVFDFLKDNNYQPYPLEHVRHITYQLCYAVK
FLHDNKLTHTDLKPENILFVDSSYETIYNAKKKREVKRVKRSDVRLIDFGSATFDHEHHS
TIVSTRHYRAPEVILELGWSQPCDVWSIGCIMFELYLGITLFQTHDNREHLAMMERILGT
VPYRMARKTKTKYFYHGKLDWDDKSCAGRYVRENCKPLHRYQAADDEEHAQLFDLMQRML
EYDPSQRICLGDALRHPFFDKIPPHQRLSEDDRERSHSLSR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatttccccgtggcgttcaaacgtgaccggtgcccgatgtgttcctgtgacgtcttcc
ttgtcgttctccaatggcgaatggcgttatcctcgacagacctcgagagagcgggaacga
gagcccaccatcgaagacgacgaagacggacacctcatttacagaattggagatgttctc
acaaacaagtggaaaatcgtggcttcgttgggcgagggaacttttggaaaagtacttcaa
gtcaaggatgtcgataatcccgataacgtgatcgcgcttaaagtaattagaaatgttgga
aaatacagagaagcggccaaattggaaataaatgctttacaaaaaatagcggaaaaggat
cccgatgggaaatatttaactgttaaaatgttatgttatttcgatttgagtggtcacgtg
tgtataggatttgaaatgttgggtcttagcgtttttgattttttgaaagacaacaattat
caaccgtatccgttagaacatgtgagacatatcacttatcagttatgttatgcagtgaaa
tttcttcacgataataaattaacacacacagatctcaaacccgagaacatattgtttgta
gattccagctatgaaaccatatacaatgctaaaaagaaaagagaagtcaaaagggtgaaa
cgttcggatgttagattaatagattttggtagtgcgacatttgatcacgaacaccacagt
acaatagtatcaacaagacattatagagctcccgaagtcattttagaattaggatggtct
caaccgtgtgacgtttggtcaatcggatgcatcatgttcgaattgtatttgggtataacg
ttgtttcaaactcacgacaacagagagcatctcgctatgatggaaagaatactaggtacc
gtaccctacagaatggctagaaaaaccaaaacgaaatatttttaccacggaaaattggat
tgggacgataagagttgcgcggggagatacgttagagaaaattgtaaaccccttcacagg
tatcaggcagccgacgacgaagaacacgcacaattattcgatttgatgcagagaatgtta
gaatacgatccgagtcagagaatatgtttgggcgatgctctcaggcatccgtttttcgac
aaaattccaccgcatcaaaggctcagcgaagacgaccgcgaaaggagccattctttatct
cggtga

DBGET integrated database retrieval system