KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM590320Help
Entry
Phum_PHUM590320   CDS       T01223                                 

Definition
peptidyl-prolyl cis-trans isomerase G, putative (EC:2.3.1.48)
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Phum_PHUM590320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 907 aa AA seqDB search
MNAKKQQSASSSESSSTSSSNSSSSSSSSSGSDSSFSDSEESSSSQNSNNKSSPENDKNV
SKRVKPVNNTAKPKKVEEKKVAPSKQINLKKGSAIYSSESDEAPVKAAPVKRRLSTTKPK
VTATVNVVQKQARNNSNSVKNTKTENSHKLISDKNNLKSSTKARSIFSPDNSSESDIEKN
VKSSGVSNNNSSKGISKTSLNNKLKENEIKKNTKRSKSSASASSTDSTDSTSDSDSSNNS
SIVNSKIKSKPILEKQDSEKTESENSRNPTKSKTSEGSEVESNKRGIITRKLTRSSSARR
SKHLTGKIGTDSESETDVKSSKTGKKVGPKGPINRNKNSKGLPSRTTTLVCDVITERKCP
VEGCNSLGHFGGNYEKHFTVEACPLYHNKTPEECRKMAEERKKRDDERKKAVMAMSRKSP
KSHSHHLNSEQRTYQLKVKEAREKFLEKMDVNDVKTEEKDREPRLEGIASEHDLRLFQEA
QAMASEKIEDDLKTLPNIKQTKYVEMGRFEMEVWYQSPYPEDYAKLPKLYLCEYCLRYMK
TRTILKRHIVKCVWRHPPGEEVYRLSVWEVDGKRYKQYCQNLCLLAKFFLDHKTLYYDVE
PFLFYVMTISDSEGCHTVGYFSKVREKTIIITSHYHVTILFKRNRLYWSSKREGKGGFWG
LNERQKMKIIGKRIESEAEGLVIGERAGGCHECGGYGGVGSRSLDSSSCPIVSQQPPLTY
TWKARSRLQKEKKKVAESSSMREEFRGLFRGVEKNSFLNYNVSCILTLPPYQRQGYGRLL
IDFSYLLTREEGKIGSPEKPLSDLGLISYRSYWKDVLLEYLCNFGGKEISIKDISQEMAI
NSYDIVSTLQALGMMKYWKGKHIILKKQDEIEEYIDRVKRRDMAHKEIDKKCLKWAPFTP
TQPQNSS
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgaaaaaacaacaaagtgctagtagttctgaatcatcatcaacaagtagttct
aattcatcttcctcatcatcaagttcgtctggtagtgattcttcattttcagattcagaa
gaatcatcatcgtcacaaaacagtaataataaatcttctcctgagaatgataaaaatgtg
tcaaagagagtaaaaccagttaacaatactgccaaacctaaaaaagttgaagaaaaaaaa
gttgctccttcaaagcaaatcaatttgaaaaaaggttccgcaatatattcatcggaatca
gatgaagctcctgtgaaagcagcacctgtcaaaagaagattatcgactactaaacccaaa
gtaactgccactgttaatgtagtacaaaaacaagctagaaataattcaaattctgttaaa
aatactaaaactgaaaattcgcataagttaatctccgacaaaaataatctcaaaagttct
acaaaggctcgaagtatttttagtccagataattcaagtgaaagcgatatagaaaaaaat
gtaaaatctagtggtgttagtaataataatagttcgaaaggaatatcgaaaacatcgcta
aataacaaattaaaagaaaatgaaatcaagaaaaatactaaaagatcaaagagttcagcc
agtgcttcatcaactgattctactgatagtacttcagattctgacagctcaaataactca
tcaatcgttaatagtaaaataaaatcgaagcccattttggaaaaacaagactcagaaaaa
acagaatcggaaaattctagaaacccgacaaaatcgaaaacttccgaaggttcagaagtc
gaaagtaataaaagaggaataataacgagaaaattaacaagatcgtctagtgctagaaga
tcgaaacatttaactggtaaaattggaaccgacagcgaatccgaaacagatgtaaagagt
tcaaaaacgggtaaaaaagtaggtccaaaaggtcccatcaatcgaaataaaaattctaaa
ggtttgccctcgagaactacaactctcgtgtgtgacgtaatcacggaaagaaaatgtccg
gttgaaggttgtaacagtttgggtcacttcggaggaaattacgaaaaacatttcacggtc
gaagcttgtcctttgtatcacaataaaacacctgaagaatgtagaaaaatggccgaggaa
agaaaaaaaagagatgacgaaaggaagaaagccgtgatggcaatgagtcgtaaatctccc
aaaagtcattctcatcatttgaacagcgagcaacgtacctaccaattgaaagtcaaagaa
gcgagagaaaaatttttagaaaaaatggatgtcaacgatgtgaaaaccgaagagaaagac
agagaacccagactggagggaatcgcttccgaacacgatctcagattatttcaagaagct
caagccatggccagcgaaaaaatagaagacgatttgaaaactcttccgaacataaaacaa
acgaaatacgtcgaaatgggaaggttcgaaatggaagtttggtatcagagtccatatccg
gaagattatgccaaattacccaaattatatttgtgcgaatattgtttgagatacatgaaa
acgagaacgatattaaaacgacacattgttaaatgcgtttggaggcatcctcccggtgag
gaagtgtacaggttgagcgtttgggaagtggatggtaaaaggtacaaacaatactgtcag
aatttatgtttgctggcgaaattttttctcgatcacaaaactctttattacgacgtcgaa
ccatttttattttacgtaatgacgatcagcgattcggaaggatgtcacaccgtcggatat
ttcagcaaggtaagagaaaaaacaattatcattacgtcacattatcacgtcacaatttta
tttaaaagaaatcgattgtattggtcgtccaaaagggaagggaagggaggattttggggg
ttaaacgaacgacaaaagatgaaaataatcgggaaaaggattgaatcggaagccgaaggg
ttggttatcggggagagggcggggggttgtcatgaatgtggcggttatggcggcgttggg
agtcgttcgttggattcgtcctcttgtcctattgtgagccagcaacctcctctcacttac
acatggaaagcaaggtcgcgattacagaaagaaaagaaaaaagttgcagaatcatcatca
atgagagaagaattcagaggtctatttcggggagttgaaaagaattcatttttaaattac
aacgtttcgtgcattttaacattaccgccctatcaaaggcaaggatacggaaggttactg
atcgatttttcgtaccttctgacaagagaagaaggaaaaatcggatccccggaaaaaccc
ctgtcggatttgggtctcatatcttatagaagttattggaaagacgttctgctcgagtac
ttgtgtaattttggtggaaaagaaataagcatcaaagacataagtcaggaaatggcgata
aattcgtacgatatcgtgagcacgcttcaagctctcggaatgatgaaatactggaaggga
aaacacataatacttaaaaaacaagacgaaattgaagagtacatagatagagtcaaaagg
agagacatggcgcataaggaaattgataagaaatgtttaaaatgggcgccgttcactccg
acacaaccgcaaaacagttcgtga

DBGET integrated database retrieval system