KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM592840Help
Entry
Phum_PHUM592840   CDS       T01223                                 

Definition
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransfer ase, putative (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Phum_PHUM592840
   00514 Other types of O-glycan biosynthesis
    Phum_PHUM592840
Enzymes [BR:phu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     Phum_PHUM592840
Glycosyltransferases [BR:phu01003]
 Terminal extension
  Sialyltransferase
   Phum_PHUM592840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 415 aa AA seqDB search
MIKTSDMKTVAFLVWIFFNLAFMSMGCYIYLIVSTYWCGQTKETIQPILDKKLLKFDKMN
HVVFYETKNESSNGVNVIASNNKYVAVLKKYSRFRRRTTRPCNNNVNCSSESHNDRLEKF
KNKLFIQLRRVLHEESNAFKMDNPYFVHYNGPRERYQMLSSNDIKCRLKKSELRLLTKKD
LSFKTLNNLRNDKNEKEEEFLEGMQYKTCAIVSSAGSLLNSKLGHLIDQHEIVVRFNHAP
TVTYEEDVGSKTTVRLVNSQVVSKKEFNFTTSSLYKNVTLVVWDPSNYSATLQEWYEKPD
FNFFERSEIHMESLGFFTKLTSMRIRKNPPSSGFLGLALLMPYCDTIDFFEFVPSTRLTK
KCHYFEDFEDDSCTFGVWHPLSAEKILSLAINEMNDSVVFNTGFIRIKGYKDLKC
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacgagtgatatgaaaacggtggcctttttagtttggatttttttcaatctg
gcatttatgagcatgggttgctacatatatttaattgtttccacatactggtgcggtcaa
acgaaggaaaccattcaaccgatacttgataaaaaattattaaaattcgacaaaatgaat
cacgttgttttttacgagactaaaaatgagtcgtcgaatggcgtgaacgttatcgcaagc
aataataaatatgtggcagttttaaaaaagtatagcagatttaggcgtaggaccacgaga
ccctgtaataacaatgttaattgcagcagtgagtcgcataatgatcggttggaaaaattt
aaaaataaattattcatacaattgagaagagttcttcacgaagaaagcaacgcattcaaa
atggataatccgtatttcgttcattataacggaccaagagaaagatatcaaatgttaagt
tcgaatgacattaagtgcagattgaaaaaaagtgaattgcgtttattaacgaaaaaagat
ttatcctttaaaaccttaaacaatttacgaaatgataaaaatgaaaaagaggaagagttt
ttggaggggatgcaatataaaacgtgtgcgatcgtcagcagtgctggatctcttttgaat
tcgaaacttgggcatttaatcgaccaacatgaaatcgtcgttcgtttcaatcatgctccc
actgtaacgtacgaagaagacgtgggatctaaaactacagtaagactcgtaaattctcag
gtcgtgtctaaaaaagaatttaattttacaacgagttctttgtacaaaaatgtcacattg
gtcgtttgggatcccagtaattactccgccactcttcaagagtggtatgaaaaaccggat
tttaattttttcgaacgatccgagatccatatggagagtttgggattttttacaaagtta
acgtctatgagaattcgtaaaaatccaccatcgtctggatttttaggtttagcattgctc
atgccctactgtgatacaatagactttttcgaattcgtaccttctactcgccttacgaaa
aaatgtcactatttcgaagatttcgaagatgacagttgcacgtttggagtttggcatcct
ctctcggcggaaaaaatattatcactagccataaacgaaatgaacgattccgttgttttc
aatacgggtttcattagaataaaaggttataaggatttaaaatgttga

DBGET integrated database retrieval system