KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM592840Help
Entry
Phum_PHUM592840   CDS       T01223                                 

Definition
(RefSeq) CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransfer ase, putative (EC:2.4.99.1)
Organism
phu  Pediculus humanus corporis (human body louse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 415 aa AA seqDB search
MIKTSDMKTVAFLVWIFFNLAFMSMGCYIYLIVSTYWCGQTKETIQPILDKKLLKFDKMN
HVVFYETKNESSNGVNVIASNNKYVAVLKKYSRFRRRTTRPCNNNVNCSSESHNDRLEKF
KNKLFIQLRRVLHEESNAFKMDNPYFVHYNGPRERYQMLSSNDIKCRLKKSELRLLTKKD
LSFKTLNNLRNDKNEKEEEFLEGMQYKTCAIVSSAGSLLNSKLGHLIDQHEIVVRFNHAP
TVTYEEDVGSKTTVRLVNSQVVSKKEFNFTTSSLYKNVTLVVWDPSNYSATLQEWYEKPD
FNFFERSEIHMESLGFFTKLTSMRIRKNPPSSGFLGLALLMPYCDTIDFFEFVPSTRLTK
KCHYFEDFEDDSCTFGVWHPLSAEKILSLAINEMNDSVVFNTGFIRIKGYKDLKC
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacgagtgatatgaaaacggtggcctttttagtttggatttttttcaatctg
gcatttatgagcatgggttgctacatatatttaattgtttccacatactggtgcggtcaa
acgaaggaaaccattcaaccgatacttgataaaaaattattaaaattcgacaaaatgaat
cacgttgttttttacgagactaaaaatgagtcgtcgaatggcgtgaacgttatcgcaagc
aataataaatatgtggcagttttaaaaaagtatagcagatttaggcgtaggaccacgaga
ccctgtaataacaatgttaattgcagcagtgagtcgcataatgatcggttggaaaaattt
aaaaataaattattcatacaattgagaagagttcttcacgaagaaagcaacgcattcaaa
atggataatccgtatttcgttcattataacggaccaagagaaagatatcaaatgttaagt
tcgaatgacattaagtgcagattgaaaaaaagtgaattgcgtttattaacgaaaaaagat
ttatcctttaaaaccttaaacaatttacgaaatgataaaaatgaaaaagaggaagagttt
ttggaggggatgcaatataaaacgtgtgcgatcgtcagcagtgctggatctcttttgaat
tcgaaacttgggcatttaatcgaccaacatgaaatcgtcgttcgtttcaatcatgctccc
actgtaacgtacgaagaagacgtgggatctaaaactacagtaagactcgtaaattctcag
gtcgtgtctaaaaaagaatttaattttacaacgagttctttgtacaaaaatgtcacattg
gtcgtttgggatcccagtaattactccgccactcttcaagagtggtatgaaaaaccggat
tttaattttttcgaacgatccgagatccatatggagagtttgggattttttacaaagtta
acgtctatgagaattcgtaaaaatccaccatcgtctggatttttaggtttagcattgctc
atgccctactgtgatacaatagactttttcgaattcgtaccttctactcgccttacgaaa
aaatgtcactatttcgaagatttcgaagatgacagttgcacgtttggagtttggcatcct
ctctcggcggaaaaaatattatcactagccataaacgaaatgaacgattccgttgttttc
aatacgggtttcattagaataaaaggttataaggatttaaaatgttga

DBGET integrated database retrieval system