KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM596050Help
Entry
Phum_PHUM596050   CDS       T01223                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase, putative
  KO
K11833  ubiquitin carboxyl-terminal hydrolase 2 [EC:3.4.19.12]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Phum_PHUM596050
Peptidases [BR:phu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Phum_PHUM596050
Ubiquitin system [BR:phu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Phum_PHUM596050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 CPT
Motif
Other DBs
NCBI-GeneID: 8239623
NCBI-ProteinID: XP_002432627
VectorBase: PHUM596050
UniProt: E0W2N3
AA seq 462 aa AA seqDB search
MGLLFIFEPEMIFSFQSSSSYNDKNVTAYLLRRFVQSLWVILLLASLLSFAVGTLAVFNI
GKCDSRRIAKESGEKCRKNFPVGDAYRQVIPEKDNLGLSGNSPRSSAGKNRNVSSTEKGG
LNGLKNIGNTCFMNSVLQCLSNTKPLLEYLLHEEYMTDINFTISAMKGSLIKAFSNVIQE
LWAPNAEDKIINTTNFKSQIQKFAPRFMGYAQQDAQEFLRYLLEGLHEDVNRVTVKPQQI
LTDIDDSLSDNQKATEAWKRYLRMDDSKVVDIFVGQLKSTLQCTVCGHCSVTFDPFWDLS
LPVPSRTGQPKLQSCLDAFTKEEVLDGEEKPTCSKCETRRKCTKSFSIQKFPKILVLHLK
RFSPTERYRGKLSITVDFPLTNLDLSPYAANKGQGCTYNLYAISNHSGTAYGGHYTAYCK
HPYSGNWHEYNDSRVSSLSSRSVVSGEAYVLFYELATQTSHL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggtttattattcattttcgaacctgaaatgattttctcttttcaaagttcgagttcg
tataacgataaaaacgtcacggcgtacctgttgcgtcgattcgtgcaatctctatgggtt
attttactactcgcatcccttttatcgtttgccgtgggtactttggcagttttcaatatc
ggaaaatgtgattcgcgtcgaatcgcgaaagagtcgggagaaaagtgtaggaaaaatttt
ccggtaggagatgcatatcgtcaagtgatacctgaaaaggataatttgggactgtcggga
aattcgccaagatcgagtgcaggaaaaaatcgcaacgtttcctcgacggaaaaaggaggc
ctcaatggtcttaaaaatattggcaacacctgttttatgaattccgttcttcaatgtctt
agcaacacgaaacctcttttggaatatttgctccatgaggaatacatgacggatattaat
ttcaccatatcggcaatgaaaggctcattgatcaaagctttttcgaacgtcattcaagaa
ctttgggcgcccaatgccgaggataaaataataaacacgacaaattttaaatcgcaaatt
caaaaattcgcaccgaggtttatgggttacgctcaacaggacgctcaggaatttttgaga
taccttctggaaggtttacacgaagacgtgaacagggtgacggttaaaccgcagcaaata
ttaacggatattgatgattcattaagtgacaatcaaaaggcgacggaagcatggaaaaga
tatcttcgaatggacgattccaaggtcgtggatatatttgtcggtcagttgaaatccacg
cttcagtgcacggtttgcggtcattgctctgtcacgttcgatccgttttgggacttgtca
ttgcccgtgccgagcagaacgggtcaacccaagttgcaatcttgtttggacgcattcacg
aaagaggaagttttggacggggaggaaaagccaacgtgttcaaagtgcgaaacgaggaga
aaatgcacaaaaagtttttctatacagaaatttccaaaaattttagttttacatttgaaa
aggttttcgcccacggaaagatacagaggaaaactttcgataaccgtcgattttccactc
accaacttggatcttagtccatacgcagcaaataaaggtcaaggatgcacttataattta
tacgcaatcagtaaccattcgggtacggcctatggcggtcactacacggcttattgcaag
catccgtattcaggaaattggcacgagtataacgattctagagtttcgagcctgtcaagc
agaagcgtagtatccggcgaagcatacgttcttttttacgaactagcgacgcaaacttca
catctctag

DBGET integrated database retrieval system