KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM602870Help
Entry
Phum_PHUM602870   CDS       T01223                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative (EC:3.1.4.11)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:phu00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:phu04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:phu04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:phu04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1197 aa AA seqDB search
MSASRVPAHIALLKPVEVPQSLVNGEKFVKWEEDSGTGTPVTLRVDKNGFYLYWVDQNNE
MDVLDFAIIRDARTGRHSKVPKDPKLKSVVTMGSQDTLEEKTITVCCGSDFVNLNFINFC
CTKKEIAQVPEGGWVDGLLKTFSDLTNKPDIILRHNAEKWCKLIEVSVPAEKNTTAKEAD
KRLKYRNLEIEITRMWGTKTETIPVININYIYIYKFYAFVSTYNYPTLLFSCSCGTSSKR
KFLTAEKFVTFLNKTQRDPRLNEILYPYANPARAKDLIQQYETNKMNAQKGQLSLDGFLR
YLMSEDNPIIASSSFDLSDDMDQPLSHYFINSSHNTYLTGHQITGKSSVEIYRQCLLAGC
RCVELDFWNGRIDEPVIVHGYTFVPEINAKEVIEAIAESAFKTSDFPVVLSFENHCNPRQ
QAKIAQYCREIFGEMLLDTPLDSHPVKPGSFLPSPAVLRHKIIIKNKKKHHHHHKKNHGG
FRSNTMDSTTTPADVVTGNGDIPHAPPLQTRQGSKESQNEDDENEEEEDVEEMKLRGNSS
GEKPTDKSASAKETEAGAEISALVNYIQPVHFTSFEVAEKKNRFYEMSSFDEKQATTLLK
ERPIEFVNYNKFQLSRVYPSGKRFDSSNFMPQVFWNAGCQLVALNYQTLDLAMQLNLGIF
EYNARSGYLLKPEFMRRKDRRLDPFAESTVDGIIAGTVSIQVISGQFLSDKRVGTYIEVD
MYGLPADTVRRKFRTKIVPNNAINPQYNEEPFIFKKVVLPELASIRITAYEESGRFLGHR
VLPVPGLCPGYRHVTLRTEAGQPLPLATLFLLIVVKDYVPDGLSDFAEALANPIKYQSDL
EKRAQQLSVLTDDCEMESNNDVSGCDCRRRRKIKRVIASVVVSMPPEPSDNAMPKFDLDS
SIVAETSSHSSPNTNKTTGTTTTTTTTTTTTHLSSSLNDVLVADSLEKLMENKVVKEKKQ
ELDKKLDVLRKKHDKERQRVTSSDCDKSKTKFYTNKLVKRLSSKNIDLGFSTHEPLDYAE
SDDSTKGSLLRTNSERLITICKDYYNQERELKEKYNETIFNLVEKLMKNSQSNQLKNLKV
LLEKETESVMRELQAARRDEVKKLSKIHKDKDEMVRIKREVDSAMIDRGVHERVRLTQLY
DRKREDLERQHEHVRQCLEEERSKVFKANLLKDHEMKVARLEEEMLSPSSSQGNVKV
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcatcgagggtacctgctcatatcgctcttttgaaacccgttgaggtaccgcaa
agccttgttaatggtgaaaaatttgtaaaatgggaagaggattctggaacgggtacgccg
gtcacgttacgggtagacaaaaacggtttttatttatattgggtggatcagaacaacgaa
atggacgtgttggattttgccatcatacgggatgcgagaacgggtcgtcattcgaaagtt
cccaaagatcccaaactcaaatcggtcgtgacgatgggatcccaggatacactagaagag
aaaacaataacagtttgctgcggatcggattttgtcaatttgaatttcatcaatttttgt
tgcacgaaaaaggaaattgcacaggtaccggagggagggtgggtggatggattgttaaaa
acgttttcggatttaactaacaaaccggatatcatactcaggcataatgcggaaaaatgg
tgtaaattaattgaggtatccgtgccggcagaaaaaaacaccacagccaaagaagcagac
aaaaggctgaaatatagaaatttggaaatcgaaataaccaggatgtggggaacaaaaaca
gaaacgattccggtcatcaacattaattatatatatatatataaattttacgctttcgtt
tcaacatacaattatccgacgttacttttttcttgcagttgcggtacatcgtccaaaaga
aaatttttaacggcggaaaaattcgtcacgtttctgaacaagactcaacgagatccgcga
ctgaacgaaatactctacccgtatgcgaatccggcgagagccaaagacctaatacagcaa
tacgaaacgaacaagatgaacgctcaaaagggacaactcagcctcgatggttttcttagg
tatttaatgagcgaggataatccgataatagcatcgtcatcctttgatttatccgacgac
atggatcaaccgctttcccattacttcattaattcttcgcacaacacttatttaacaggg
catcaaatcactgggaaatcgtcggtggaaatttacaggcagtgtttgttggcgggttgc
cgatgcgtggaattagatttttggaacgggagaatcgacgaacctgtcattgttcacggc
tacacattcgtgcctgagataaacgcgaaagaagtcattgaagccatagcggaatccgca
tttaaaacgtcggatttcccggtcgttctctcgttcgaaaatcactgcaatccgaggcag
caagcgaaaattgcacaatactgtcgggaaatattcggtgaaatgctgttggacacgccg
ttggactcgcatccggttaaaccgggtagttttttaccatcgccggcggtactccgtcac
aagataataattaaaaacaaaaagaaacatcatcatcatcataagaaaaatcacggggga
ttcaggtcgaacacgatggacagcacgacgacgccggcggatgtggtgacgggaaacggt
gacataccacacgcgccaccgttgcaaacgcgacagggaagcaaggaaagtcaaaacgaa
gacgacgaaaacgaagaagaggaagacgtggaagaaatgaaacttcgcgggaattcttcg
ggtgaaaaaccgacggataaatccgcgtcggcaaaggaaacggaagcgggagcggaaata
tccgctctcgttaattacatacaacccgttcatttcacgtctttcgaagtggccgaaaaa
aagaatagattttacgaaatgtcatcgttcgacgagaaacaagcgacgactttattaaag
gaaagacccatagaattcgtgaattataataaatttcaattgtcaagggtttatccctca
ggaaaaaggttcgattcgtcaaattttatgcctcaggtgttttggaacgccggatgtcaa
ttggtcgcattgaattatcaaactttagatctcgcgatgcagttaaatttaggaatattc
gagtacaacgcacgatccgggtatttactcaaaccggaattcatgaggagaaaggatcgt
cgtttggatccttttgccgagtcgacggtggatggaatcatagcgggtaccgtttcaata
caagtgatatcggggcaatttttgagcgacaaacgcgtgggtacttacatcgaggtggac
atgtacggattacccgcggacacggtgagaaggaaatttcgtacgaaaatcgtacccaac
aacgcgatcaatcctcaatacaacgaggaacctttcatattcaaaaaggtcgtcctcccc
gagttggcttcaattagaatcacggcgtacgaagaatccggacgatttttgggacacaga
gtattacccgtacccggattatgtcccggttacaggcacgtgacactgagaacggaagca
ggacaacctttacctttggcgacgcttttccttttgatcgtcgtcaaagattacgtgccg
gatggtttgtcggatttcgccgaagcactggccaatccaataaaatatcaaagcgatttg
gaaaaaagagcgcagcaattgtccgtactaacggacgattgcgaaatggagtcgaataac
gacgtgagtggttgtgattgtcgccgtcgtcgtaaaataaaaagagtgatagcttccgtc
gtggtttcaatgccgccggaaccgtcggacaacgcgatgcccaaattcgatttggattcg
tcgatcgtggcggaaacgtcgtcgcattcgtctccgaacacgaacaaaacgacgggaacc
acgacgacgacgacgacgacgacgacgacgacgcatttgtcgtcgtcactgaatgacgtt
ttggtagcggattcccttgaaaaattaatggaaaataaagtggttaaagaaaagaaacag
gaattggataaaaaactcgacgtgcttaggaaaaaacacgataaagaaaggcagagagtg
acgtcgtcggattgcgacaaatcaaaaacgaaattttacaccaacaaattagtcaagagg
ctatcgagtaaaaacatagatctcggtttttcaacgcacgaacccttggattacgcggaa
tcggatgattcgacgaagggaagtctattgagaacaaattccgagagactgataacgata
tgcaaagattattacaatcaagagagagaactaaaggaaaaatataacgaaacgatattt
aatctcgttgaaaaactaatgaaaaactcgcagagcaatcagttgaaaaatttaaaggtt
ttgctggaaaaggaaacggaaagcgttatgcgagaactccaggcggcgagaagagacgaa
gttaaaaaattatcgaaaattcacaaagacaaagacgaaatggtgagaatcaaaagagaa
gtcgattcggcaatgatcgatcgtggagttcacgaacgcgtgagattgacacagttgtac
gataggaaaagagaagatttagaaaggcaacacgaacacgttaggcaatgtttagaagag
gaaaggtcaaaggtcttcaaagcgaatttattgaaagatcacgaaatgaaagttgcaaga
ttagaagaagaaatgttatcgccatcgtcgagtcagggaaatgttaaagtttaa

DBGET integrated database retrieval system