KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM604220Help
Entry
Phum_PHUM604220   CDS       T01223                                 

Definition
calcineurin subunit B isoform, putative
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM604220
Protein phosphatases and associated proteins [BR:phu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Phum_PHUM604220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 162 aa AA seqDB search
MELCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDADGNG
EVDFKEFIQGVSQFSVKGDKESKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQ
LQQIVDKTILFADKDEDGKINFEEFCNVVGNTDIHKKMVVDV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtgctctaatttcgatgcagatgaaatacgtagattaggaaaaagatttcga
aaactcgatttggataattcaggtgcgttaagtattgatgaatttatgtcattgccagaa
ttacagcaaaacccattagtacaacgggttatagatatattcgatgctgatggtaatgga
gaggttgattttaaggaattcattcaaggtgtatcacaattcagcgttaaaggtgataaa
gaatctaaattaaggtttgcattcagaatttacgatatggataacgatggatatatttca
aatggtgaattatttcaggttttaaaaatgatggtcggtaacaatttaaaagatacgcaa
ttacaacaaattgtcgataaaacaatattgtttgccgataaggacgaagatggaaagata
aattttgaagaattttgtaatgttgtcggaaacaccgatattcataaaaaaatggttgtg
gacgtgtaa

DBGET integrated database retrieval system