KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM615880Help
Entry
Phum_PHUM615880   CDS       T01223                                 

Definition
6-phosphofructokinase, putative (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:phu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:phu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:phu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:phu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:phu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:phu00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 792 aa AA seqDB search
MEPEKIKFIKRGSHKGKGLAVFTSGGDSQGMNATVRAVVRMGIYLGCKVYFIKEGYQGMV
DGGDNIVEANWSSVSSIIHKGGTVIGSARCSDFREREGRLKAAKNLVLKGISNLVVIGGD
GSLTGANLFRQEWPSLLAELVNTGEIQQEASDQYSHLHIVGLVGSIDNDFCGTDMTIGTD
SALHRIVEAIDAIASTAYSHQRTFIMEVMGRHCGYLALVTALTSEADYVFVPESPPPNDW
PEKLCSKLEQIGQLNYAERQIGQRLNIIIVAEGAIDRDGKPITAEMVKEVVVSKLKQDTR
ITVLGHVQRGGNPSAFDRILGCRMGAEAVMALMEAQPETEACVVSLDGNQAVRLPLMQCV
EKTKAVSKAMAEKDWSKAVELRGRSFHRNLEIYKMLTRLKPPTLDENKKDQGGLTLGVMH
IGAPACGMNAAVRSFVRNCIYRGETIMGIHDGIEGLCNGNVQKMTWADVTGWIALGGAML
GTKRTLPSKKFPETAAKLKEFGIQGLLIIGGFEAYQGALQLYENRDKYPEFRIPIVVIPS
TISNNVPGTDFSLGSDTALNEITEICDRIRQSAQGTKRRVFIIETMGGFCGYLATLAGLA
GGADAAYIFEEKFSIKDLQQDVYHMASKMAEGVQRGLILRNEKANDNYNTDFIYRLYSEE
GKGLFSARMNVLGHMQQGGSPTPFDRNLGTKMGAKTVEWISRKVKESLQPDGTVCANTPD
SAVLLGVIRRQYKFTPLEEIVSYTNFEQRIPMVQWWLHLRPLLRILAKHDSTYEEEGMYM
TVEETSEDNPLI
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgaaaaaattaaatttattaaaagaggttcacataaaggaaaaggtttagca
gtttttacaagtggtggagattctcaaggtatgaatgcaactgttagagcagttgttaga
atgggaatttatttgggttgcaaagtttattttattaaagaaggatatcagggcatggtt
gatggcggtgacaatattgtcgaagccaactggtcatctgtttcctcaattattcacaag
ggtggtactgtaatcggttctgcaaggtgcagtgattttagagaaagagaaggaaggtta
aaagcagccaaaaatcttgttttaaaaggaattagtaatttagttgttattgggggtgat
ggatcactgacaggtgctaatttatttagacaagaatggccttcactattagcagaactt
gtaaacactggtgaaattcagcaagaagcaagtgatcagtatagccatttacacatagtt
ggattagtcggttcaattgataatgatttttgtggaacggacatgacaatcggaacagat
tcagcacttcatagaattgtcgaagctatcgatgcgatcgcttcgactgcttattctcat
cagagaacatttattatggaagtaatgggaagacattgtgggtatttagccctagtaaca
gctctaacgagtgaagctgattatgtatttgttcctgaaagtccacctccaaatgattgg
cccgagaaactttgctccaaattagaacagattggccaattaaattatgcagaaagacaa
atcggacaacggttaaatataattattgttgccgaaggagccatcgatagagatggaaaa
ccaataacagcggaaatggttaaagaagttgttgttagcaaattaaaacaagatacgaga
ataaccgttttgggtcacgttcaacgtggaggaaatccatctgcttttgacagaattttg
ggatgtcggatgggagctgaagctgtcatggctttaatggaagctcaaccggaaacggaa
gcttgtgttgtttccctcgatggtaatcaggctgtgagactacccttaatgcaatgcgtt
gaaaagacaaaagccgtctctaaggcaatggcagaaaaagattggagtaaggctgtggaa
ttgcgtgggaggagttttcatagaaatttagaaatttataaaatgttaacaagattgaaa
cctcccactttagatgaaaataaaaaagatcaaggaggtttaactttgggtgttatgcat
atcggagcaccggcttgcggaatgaatgccgcggtgagaagttttgtacgaaattgcatt
tacagaggagaaacaattatgggaatccacgatggcatcgagggtctatgcaacggaaac
gttcaaaaaatgacttgggcggatgtcactggttggatagcattaggtggagctatgcta
ggaactaaaagaacattgccgagtaaaaaatttcccgaaactgctgccaagcttaaagaa
tttggaattcaaggattgctgattatcggtggattcgaggcatatcaaggtgctttgcag
ttgtacgaaaatagagacaaatatccagaatttcgaatacctatcgtggttattccatcg
accatatcgaataacgttcccggaacggatttctccttggggagtgatactgctttgaat
gaaataaccgaaatttgcgacaggattcgtcaatctgctcagggaaccaaacgacgagtt
ttcataattgaaacaatgggtggtttttgcggatatttagccacactcgcaggtttggct
ggtggcgccgatgctgcgtacatattcgaagagaaattttccataaaagatttacaacaa
gatgtttatcacatggcatcgaaaatggccgaaggagttcaaaggggtttgatattaaga
aatgaaaaagccaacgataattacaatacggatttcatatacagattatattcggaagaa
ggaaagggactgttcagcgccagaatgaacgttttaggacacatgcaacagggtggttcg
cccactcctttcgatcgtaatttaggtaccaaaatgggcgcgaaaacggtcgaatggata
tctcgaaaagtgaaagaatctttgcaaccggatggaacggtttgcgccaacacaccagat
tctgccgtgcttttaggtgtcattcggagacaatacaaatttacacctctcgaggaaatc
gtttcgtacactaatttcgagcaaagaattccgatggtccaatggtggcttcatcttaga
cccttattaagaattctcgccaaacacgatagtacatacgaagaagagggtatgtacatg
acggtcgaagaaacaagtgaagataatcctttaatttaa

DBGET integrated database retrieval system