KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM616140Help
Entry
Phum_PHUM616140   CDS       T01223                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase, putative
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:phu00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 180 aa AA seqDB search
MVQAWYMDNSTEDQRLQHHRTPPKFIDMNELFKRTGVEYFKVNEKDPVNDDLLIKLKKER
CYSYEDEITCSEQCLPNYHEKLKNFFTEHLHTDEEIRLVLEGSGYFDVRDPSDEWIRIFV
QPGDMIIIPSGIYHRFTLDDKNYIKAKRYFIGEPVWTPHNRPADNMPCRQEYLGKLLKGF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagcatggtacatggacaattcaacagaagatcaaagattacaacatcacaga
actcctccaaaatttatcgatatgaatgaattgtttaaaagaacaggtgtcgaatacttt
aaagtcaatgaaaaagatccagtaaatgatgatttgttaataaaattaaaaaaagaaaga
tgctattcgtatgaagatgaaatcacatgctcagaacagtgccttccaaactaccatgaa
aaattaaaaaatttttttacagaacatttgcatacagatgaagaaatcagacttgttcta
gaaggttcaggatattttgatgtcagagatcctagcgatgaatggatcagaatatttgtt
caaccgggtgatatgattattatcccatccgggatttatcacagattcacattagatgat
aagaactacatcaaagcgaaaagatactttatcggagaacctgtttggactccccacaac
agaccagctgataacatgccatgcagacaagaatatttgggaaaacttttaaaaggattt
taa

DBGET integrated database retrieval system