KEGG   Scheffersomyces stipitis: PICST_15102Help
Entry
PICST_15102       CDS       T01023                                 

Gene name
RDH54
Definition
helicase (EC:3.6.1.3)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
pic  Scheffersomyces stipitis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PICST_15102 (RDH54)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     PICST_15102 (RDH54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 809 aa AA seqDB search
SKERYAVQWRKRTNKKNKTWDGDGYIVVYRDAASNSSFTIAFKQLEAKNVIRKQFTNVNV
DQILRGLITIGQNELEVDYMINTDAEFRRLTGEEEEGSESLSSNLSQSTIPSKPSKPMAY
RKMIPKNYEVTTSNRHTRAPLYNDSRAIALPRPPGVNENELVDVLIDPHLSVKLRPHQVE
GVKFVYECLMGFRGNNGKGCLLADEMGLGKTLMTITVIWTLCRQNPFIKQPRSTIHKVLI
CCPVSLINNWKDEFKKWLGMNKLSILTLGGNVSSNDRQDLVSFGNLNVYQVLIMNYEKVT
TYHQELSKIRFDLLVCDEGHRLKSSSNKVMNHLTSFNIPRKILLTGTPIQNDLVEYYTII
NFINPGILGDFKSFQKSFINPITRSRDVTCFDPVVKEQGLEISNKLIDITKQFTLRRTQS
LLLNYLTEKTDVILYAPPTDLQKRLFSYIINLKSFNELMNDSASTTTQAFTLINLFKKLC
NSPSLLLEDNFFSKLIKGEKEEIELLNKNTLTTSSGKINILIPLLLEITSFNEKIVLVSN
YTKTLDLLEAVLKKLDLSFLRLDGSTAKNLRNKLVNQFNKSNINVFLLSSKSGGMGLNLV
GASRLILFDNDWNPSVDLQSMSRIHRDGQTRPCFIYRILTTGTIDEKIFQRQLMKSKLSS
KFLDNESQSTSDVFDYRDLKNLFEIEENTISNTHDLLECECTGDGHNISVSLTDSESDSD
AEGFLSAHRQSSWMSASDLRDKLEKDEKKKLSIKDALNEYRHFDPATDADKVCQHINDKV
LVNIINNKGYNKKTFPISFIMTRVSDRTT
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
tcaaaagaaagatatgctgttcaatggaggaaaagaaccaacaaaaagaacaagacttgg
gacggcgacggatacatagtggtataccgggatgccgcttctaactcgtcttttactatt
gcattcaaacagttggaggctaaaaatgttataaggaaacagttcacaaatgtgaatgta
gatcagattcttcgaggtttgatcactattgggcaaaacgagctcgaagtcgattacatg
atcaatacggatgctgagtttcgtagattgacaggagaagaagaagaaggatcggagtct
ttgtcatcaaacctttcccaatctacaataccgtctaaaccatcaaaacctatggcatac
agaaaaatgataccgaagaactatgaggtcaccacttccaatagacatacccgtgctcct
ctctataacgattcaagggctatagctttgcctcgacctcctggtgtgaatgagaatgaa
cttgtagatgtattgatagaccctcatttatctgtcaagttgagacctcatcaggtggaa
ggagtcaaatttgtgtatgaatgtcttatgggcttcagaggaaataatggaaaaggatgt
cttttggctgacgaaatgggactaggcaaaacccttatgacaattaccgtcatctggacc
ttatgcagacagaacccttttatcaagcagcctaggtcgactattcataaagtattgata
tgttgtccagtttctcttatcaacaactggaaagatgagttcaaaaagtggttgggtatg
aataagttatcaatacttacgttaggtgggaatgtctcttcgaacgatagacaagattta
gtttcatttggcaatctcaatgtttatcaagtcttaatcatgaactacgagaaggttacg
acttaccaccaagaactttccaagattaggtttgacctattagtttgtgacgaaggtcat
cgtttaaagagcagtagcaataaagtcatgaaccatttgactctgttcaatatccccaga
aagatcttattaactgggacacccatacagaatgacttagtggagtattataccatcatt
aatttcatcaatcctggcattttaggcgatttcaagtcatttcagaaatcttttatcaat
ccaattactaggtctagagatgtcacttgctttgatccagttgtgaaagagcaaggattg
gagatttctaacaaattgatagacataacgaagcagttcaccttaagaagaacacaatca
ctacttcttaactatttgaccgaaaagactgatgttatattgtatgctccaccaacagat
ctccagaaacgattgttcagttacataatcaatctaaagtcattcaacgagttgatgaat
gattcagcttccactacgacacaagcatttaccttgataaacctattcaaaaagctatgt
aattcgccgtccttattgctcgaagacaacttcttttcaaaattgatcaaaggagagaaa
gaagagattgagttgcttaacaagaatacattgacaacctcgtctggaaaaatcaatatc
ttgattccattattgctagagatcacgtctttcaacgagaaaattgttctcgtatcaaac
tacaccaaaactctcgacttactagaagcagtgttaaagaagttggatttatcctttttg
agactcgatggatctactgctaagaacttacggaacaagttggtaaaccaattcaacaag
tctaatatcaatgtattcctattgtcttccaaaagtggaggtatgggtctcaatcttgtt
ggagcatccagattaattctcttcgataatgattggaacccttctgtagatttgcaatca
atgtctagaatccatagagatggacaaactcgtccctgcttcatctacagaattctcact
actggcaccattgacgaaaagatatttcagagacagctaatgaagagcaaattgagttcc
aaatttttggataacgaatcccaatcaacatccgatgtttttgactatcgtgatttgaag
aacttgtttgaaattgaagagaacacaatctctaacactcacgatttactagagtgtgaa
tgtacgggcgatggacacaacattagtgtcagtcttacagatagtgaatccgattctgac
gcagaaggattcctcagtgctcataggcagagtctgtggatgtcagctctggacttgcga
gacaaacttgaaaaggatgaaaagaagaaattgtcaatcaaagatgctcttaacgaatat
agacatttcgacccagccacagatgctgataaagtctgtcagcatattaacgacaaggta
ctagttaatatcatcaacaacaagggttacaataagaaaacatttcccatcagtttcatc
atgacaagggtttctgacagaactact

DBGET integrated database retrieval system