KEGG   Scheffersomyces stipitis: PICST_27980Help
Entry
PICST_27980       CDS       T01023                                 

Gene name
ADH2
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:pic01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pic00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pic00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pic00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 348 aa AA seqDB search
MSIPTTQKAVIFETNGGPLLYKDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLDTK
LPLVGGHEGAGVVVALGENVTGWEIGDYAGIKWINGSCLQCEYCVTAHESNCPDADLSGY
THDGSFQQYATADAIQAARIPKGTDLALIAPILCAGITVYKALKTAQLQAGQWVAVSGAA
GGLGSLAIQYAKAMGYRVVGIDGGADKGEFAKSLGAEVFVDFLSSKDVVADVLKATNGGA
HGVINVSVSERAMQQSVDYVRPTGTVVLVGLPAGAKVSASVFSSVVRTIQIKGSYVGNRA
DSAEAIDFFTRGLIKCPIKIVGLSELASVYELMEQGKILGRYVVDTSK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctattccaactacccaaaaggccgttatctttgaaaccaacggtggtccattgctc
tacaaggacatcccagtcccaaagccaaagcctaacgaattgttgatcaacgttaagtac
tcgggtgtctgtcacaccgacttgcacgcctggaagggtgactggccattggacaccaag
ttgccattggtcggtggtcacgaaggtgctggtgttgttgtagccttaggtgaaaacgtt
actggttgggaaatcggtgactatgctggtattaagtggattaacggttcttgtttgcaa
tgtgagtactgtgtcactgctcacgaatccaactgtccagatgcagacttgtctggttac
acccacgatggttctttccaacaatatgccactgctgatgccattcaagctgccagaatt
ccaaagggtactgacttggccttgattgccccaatcttgtgtgctggtatcactgtatac
aaggcattgaagacagcccaactccaagctggtcaatgggttgctgtttccggtgctgca
ggtggtttgggttctcttgctatccaatatgccaaggctatgggttacagagtcgtaggt
atcgatggtggtgccgacaagggtgaatttgccaagtctttgggtgctgaagtttttgtt
gacttcttgtcttccaaggacgttgtagctgatgtcctcaaggctaccaacggtggtgct
cacggtgtcatcaacgtgtctgtctctgagagagccatgcaacaatccgttgactacgtc
agaccaacaggtactgttgttttggtcggtttaccagcaggtgctaaagtgtccgcctct
gtattcagctccgtcgtcagaaccatccaaattaagggatcttatgtcggaaacagagct
gactccgctgaagccattgatttcttcaccagaggcttgatcaagtgtccaattaagatc
gttggcttgtccgaattggccagtgtctacgaattgatggaacaaggtaagatcttgggt
agatacgttgttgacacctccaagtaa

DBGET integrated database retrieval system