KEGG   Scheffersomyces stipitis: PICST_28187Help
Entry
PICST_28187       CDS       T01023                                 

Gene name
WSC3
Definition
cell wall integrity and stress response component 3 (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pic00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 265 aa AA seqDB search
MHAIRNVEDSGMSDSDSTISNSSTISFSSLKTPDRRTSRMRGSTASTSTNASFTSAASTF
SSAASAFTATTASTSLTRDTRDSAKVPVSVVPSPSSTYVYTRDGRLAPCVAYVVAQLKMM
SEQASEDKEAGSGIEVASRRGTTLSNVQVIYFNNTGPYELITLVDNDNLGRIIDYEQIDT
IQEIRNKIGEKAKAMPESTRLVVVIENLYSILESPQAQLSYNEKNQLLVSVVRKATSGTT
PYALFLVDKEYSSYVSMLVDEEVEV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcaattaggaatgtcgaagattcaggaatgtctgattcagactcgacaatttca
aactcgagcacaatctcattttccagcttgaagacgccagacagacgcaccagtcgtatg
agagggtcgactgccagcacatccaccaacgcatcctttacactggccgcttccacgttt
tcgtcggccgcttcagcgttcacggctaccacagcatctacgtctttaaccagagacacg
agagactccgctaaagttccagtgtcggtggttccttcgccatcctcgacatatgtctac
accagagacggccgtttggcaccctgtgtcgcctacgttgttgcccaattgaagatgatg
tccgagcaggccagtgaagacaaggaagccggtagtggtatcgaagttgccagtagaaga
ggcactactctttcgaatgtccaggtgatctacttcaacaatactgggccctacgagctt
ataacgcttgtggataacgataacctagggaggattatagactacgagcagatcgatacc
atacaagagatcaggaacaagatcggcgagaaggccaaggcgatgcccgagagcacaaga
ttggtggtggtgatcgagaacttgtatctgattttagaactgccacaggcgcagctctcg
tacaacgagaagaaccagttgttggtgagtgtagtgaggaaggctacgagtggaacgacg
ccgtatgcgttgtttctagttgacaaggagtacagcagctacgtgagcatgttggtggat
gaagaggtagaggtgtag

DBGET integrated database retrieval system