KEGG   Scheffersomyces stipitis: PICST_28965Help
Entry
PICST_28965       CDS       T01023                                 

Gene name
CKT1
Definition
choline kinase (EC:2.7.1.32)
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PICST_28965 (CKT1)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PICST_28965 (CKT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 557 aa AA seqDB search
MDITPANVSVQPRSRSRSRTRNSTANSRSTSSTRRPSVGKRSLSSSSLTKLVVTPTNIDH
EKSVPTVSATLDNSLPLDFFKQDLIALVKTLKISKWHKRQLTISNLVVNRISGALTNSIY
RIEYYDSQQNLSLPTLLLRVYGKNVEELIDRDSELATLIKLSQKRIGPRLLGIFANGRFE
QFLDGFITLNKVQIRDEIISQMLGRRMKDLHYKIELDLHDVLSDLPTAWRLIFKWLKLFE
EEYLPGYTKNNFDPKDVFFVEFGRFKEIVNLYKNWLFDKYDKESFSSNYKFCHNDTQYGN
LLLHESFNPEDILVETPVPSTPTDESTPVIKSTSNKNDSKLVVIDFEYSGANFPAFDLVN
HFSEWMADYHDEEKSYYIHEDKYPTQLQQLNLIKSYIEYDFQFPSSNLKTPNTPEQLLNG
TADASELIQYEIKKMYNECIYWRATVQIFWCLWGVIQNGPLKPSSPASPNPNGFAEDGID
STYNIITGVESVSLDGNVVVEEAISSSDDDFDYLKYSQQKVAIIVGELISFGLIKKEEID
EKYWDIIKYLDVKTLDI
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggatatcacaccagccaacgtttccgtccagccacggtctagatcccgttcgagaaca
agaaactcgactgccaactcgagatccacttcttctacaagaagaccgtctgttggaaag
agatccttatcgtcgtcttctttaacgaagttagttgtcacgcctaccaacatcgaccac
gaaaaatctgtcccaactgtctcagcgactttggataattctttgccgctcgatttcttc
aaacaagatttgattgctttggtcaagacgttgaagatttcgaaatggcacaagagacag
ttgaccatatccaacttggtggtgaatagaatctcgggtgcgctcacgaactccatctac
cgtatcgagtactacgacagccaacagaacttgagcttgccaaccttgttattgagagtg
tacggtaaaaacgtcgaagaactcatcgatagagacctggaattagctactttaatcaag
ttgtcacaaaagagaatcggtcctagacttcttggaatcttcgctaatggtagattcgag
cagtttttagacggattcatcacgttgaacaaagttcagatcagagacgaaattatctcc
cagatgttgggtagaagaatgaaggacttgcactacaaaatcgaattagaccttcatgat
gttttgtccgatttgcctacagcttggagattgatcttcaaatggttaaagctttttgaa
gaagaatacttgccaggatacaccaagaacaactttgaccccaaagacgtgttttttgta
gagttcgggagattcaaggaaatcgtcaatctctacaagaactggctctttgataaatat
gacaaggaatcgttttcgtccaactacaagttttgtcacaacgatacccagtacggtaac
ctcttgttgcacgaatcgttcaacccagaggatatacttgtagaaactccggttccatct
actcctacggacgagtcgactcctgtaatcaagtctacctctaacaaaaacgatagtaaa
ttagttgtaattgacttcgaatattctggagctaacttcccggcttttgacttggtaaac
catttctcagagtggatggctgattatcatgacgaagagaagtcgtactatatccatgaa
gacaagtaccctactcagttgcagcagttgaatttgatcaagtcttacatcgaatacgac
ttccaattcccctcttccaacctcaagacgccaaatactccagagcagctcttgaatggg
acagccgatgccagtgagttgatccagtacgaaatcaaaaagatgtacaacgaatgcatc
tactggagagccactgtccagattttctggtgtctctggggagtaatccagaatggtcca
ctcaagccttcttcccctgcatcgcctaatcctaacggatttgctgaagacggtatagac
agtacttacaacatcatcactggtgtagagtctgtgtctttggacggaaacgtagttgta
gaagaggctatttcctctagtgatgatgacttcgactacttgaagtactcacagcagaag
gttgctattattgtcggcgagctaatcagttttggcttaattaagaaggaagagatcgac
gagaagtattgggacatcatcaagtatttggatgtcaagacattagatatttag

DBGET integrated database retrieval system