KEGG   Scheffersomyces stipitis: PICST_29301Help
Entry
PICST_29301       CDS       T01023                                 

Gene name
PRO2
Definition
Glutamate 5-kinase (Gamma-glutamyl kinase) (GK)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pic  Scheffersomyces stipitis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PICST_29301 (PRO2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PICST_29301 (PRO2)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PICST_29301 (PRO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 447 aa AA seqDB search
MSPKVYTIVVKLGTSSLVDEVTREPRIANMSLIVETISKLRRQGHKIVIVSSGAIAFGMK
RMSMEKKPSKLAAVQALASIGQGRLIGLFDDLFRQLDQRIAQILITRNDIMDFTQYRNAR
NTLNELLDMGVIPIVNENDTLSVAEIKFGDNDTLSAITAGMIHADYLFLMTDVQCLYTDN
PRSNPDAKPILLVDKIDDLAVKTDTDSGAGSQVGTGGMTTKLIAAELATNAGVTTIITLS
SQPYYILDIVKNIQSTATEHLTIEEQIQQMEKDIDSNKIPLHTRFQGLPRNTQIKSDRKF
WILHGLKTKGDIIIDEGCFKALTRKDRAGLLPAGIIDVIGTFHESECVSIKVVPTRTSPV
DEAIEVGHCRVNYASSEILKIKGLRSSQIESTLGYADSEYVAHRDNIAFPPVLPPSSENL
ASLALSENENHNHYHNHHNHNHNHERD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccaaagtgtacaccatagtcgtgaaactcggtacatcgtcgcttgtagacgaa
gttacacgagagcctcggatagccaatatgtcgctcatagtagaaaccatctccaagctt
cgtcgtcagggtcacaagatagtgatagtatcttctggagcaatagcctttggaatgaag
cgtatgagcatggaaaagaagcccagcaaacttgctgctgttcaagcgttagcctcgatt
ggtcagggacggctaataggtctttttgacgatttgttcagacagttggaccagagaatc
gcgcagatcttaatcactagaaatgacattatggattttacccagtatagaaatgcccgc
aacacgttgaatgagttgctcgacatgggagttattcctattgttaacgaaaatgatacg
ttgtcagtggcggaaatcaagttcggtgataacgatacgctttcagccatcaccgctgga
atgatccatgccgattacctattcttgatgacggacgtgcagtgcttgtacacggacaat
ccccgtagtaatcctgatgctaagcccatcttgttagtggataagatcgacgacttggct
gtgaaaacagacaccgacagtggggcaggatctcaagttgggacaggtggcatgactacg
aagctcatcgcagcagaactagcaacaaacgccggagttaccaccatcatcaccttgtcg
agtcagccttactacattctagatattgtgaaaaacattcagagcacagctacggagcat
ttgacgatagaggaacagatacagcagatggaaaaagacatagatagcaacaagattcct
ttacatacccgtttccaaggtcttcccagaaacactcagatcaagtcagaccgcaagttc
tggatcttgcacgggttgaagaccaagggtgacatcatcattgatgagggctgtttcaag
gctctcacgcgtaaggaccgagctgggctcctcccagcaggaatcatcgatgtgataggc
actttccatgaaagtgaatgtgtctccatcaaggttgttcctacgaggacttcacctgtg
gatgaagctatcgaagttggacattgtagagttaactacgcttcgtctgagatcttgaag
ataaagggcttacgaagcagtcagatcgaatccaccttgggctatgctgattccgagtac
gtggctcacagagacaacatcgcctttccaccggtgttgcctccatcttcagagaacctt
gccagtttggcgttgtctgaaaatgaaaatcataatcactaccataatcatcataaccac
aatcacaatcatgaaagggattaa

DBGET integrated database retrieval system