KEGG   Scheffersomyces stipitis: PICST_29380Help
Entry
PICST_29380       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PICST_29380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 357 aa AA seqDB search
MSDGRTQAKKSVPKDEGYDNGFYGVLDKPNIKTVLFGNYRFNTWYGNAAYFNAYDTAHMA
LGYDFSNRIASDPSTVTNTENSNIDNNHNDDDYWLNELYVCEYCFKYTSNSHEMQQHRVV
CSYNVARPKVGKLLYRDDHTPYLIREVRGFTDPLFCQNLCLFGKLFLDDKSVYYNIDHFN
FYIVYGYDNDVNADPYTEQHFKPMGFFSKEMLAYDNDNNLACICVFPPFQRRHLGSLLIE
FSYALAHVTPGQYHSGPEFPLSPYGKVSYLRFWSKKLASVITSHFKPGSSFSLNDISDFT
GFRKEDILLTLEYMKLLKKDSRGNVKLLLGNLQEWCTANNVDPNQEKSMMNTEYLLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgggcgaacgcaggcaaagaagtccgtgcccaaggatgagggatatgataac
ggcttctatggcgtattggacaaacccaacataaagaccgtgctctttggcaattaccga
ttcaatacgtggtacggcaatgcagcgtatttcaacgcttacgatacagcccatatggct
ttgggatacgacttttccaatcgtatcgcctcagatcccagtacagtcacaaatactgaa
aactccaacatcgataataaccataatgatgacgactactggttgaacgaactttatgta
tgcgagtactgtttcaaatatacctccaattcacacgagatgcaacagcacagagtggtc
tgctcatataatgtggccagaccgaaagtgggaaagctcttgtatcgagatgaccatacc
ccatatctcatacgagaagtgcgaggattcactgatcctcttttctgtcagaacctctgt
ttgtttggtaagctctttctcgacgataaatctgtgtactacaacatcgaccatttcaac
ttctatattgtttacggctatgacaacgatgtaaatgctgacccttacactgaacaacac
ttcaaacccatgggtttcttttcaaaggaaatgctagcttacgataacgacaataaccta
gcatgcatctgtgtatttcccccgtttcaaagacggcacttgggctcattgctaatagag
tttctgtacgcgttggcgcatgtcactcctggccaataccacagtggacctgaattccca
ctctctccgtatggcaaggttagctaccttcggttctggtccaaaaagttggctagtgtg
ataacttcgcatttcaagcctggtctgtcgttcagtttgaatgatatttccgacttcacc
gggtttagaaaggaagatatcttgctcacgttggagtacatgaaactcttgaagaaagac
ctgcggggcaatgtgaagttgctccttggaaatcttcaagaatggtgcactgccaataat
gttgacccgaaccaggagaagtctatgatgaatactgagtaccttctactataa

DBGET integrated database retrieval system