KEGG   Scheffersomyces stipitis: PICST_29855Help
Entry
PICST_29855       CDS       T01023                                 

Gene name
TFB2
Definition
RNA polymerase II transcription factor B subunit 2 (RNA polymerase II transcription factor B p52 subunit) (RNA polymerase II transcription factor B 52 kDa subunit)
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pic  Scheffersomyces stipitis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PICST_29855 (TFB2)
  Replication and repair
   03420 Nucleotide excision repair
    PICST_29855 (TFB2)
Transcription machinery [BR:pic03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PICST_29855 (TFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 515 aa AA seqDB search
MSSSNLFKATVNEYLEGLPQPVQSKLYEAPATCLAIFRLLTPMAKFYIMTMLFNDRPVAL
RDLDRWCKPHAKKLQFDSLKRLTSLHLIEEDRGGNHIRLNPTFRQNFRNCLTGSQQSNAF
GNLCTTTDKHRVDISFLDNFASSKWETILHFMVGTEATATPTTSVLSLLKSGGLMEGPGN
SPQNLKITNTGFQFLLQDVNAQIWTLLLQYLNLTQELHMDPVDVLNFIFVLGSLELGKSY
LVSSLSATQVSMLADLRDYGLVYQRTDSSGRFYPTRLATTLTSDSAALKTPSMAIEQALG
ASDGGEEQQIDTPTGNQGTVIIETNFKLYAYTNSPLEIAILNLFVHLKSRFTNMVCGQIT
RESIRSALYNGITADQIIKFLETHAHPQMKLLAKEKLDKKIEFDTSHNINTAGGAPQSKV
SGEGNVAQHKLEILPPTVVDQIKLWQLELDRIQTFDGYLFKDFSNQQEFDTLSNYASEVG
VLVWSDKIKKKFFVTAEGMTQVAEFANRKFQRNRQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccagcaatctattcaaggctacggtcaatgagtacctcgagggccttccacag
cccgtacaatctaagttgtacgaggcccctgcgacttgtctagccatttttagattgtta
acacccatggccaagttctatataatgacgatgttattcaacgatcgaccggtagcactt
cgagatttggacagatggtgcaagccacatgcaaaaaagttacagtttgactctcttaaa
cggttgacatcattgcatttgatagaagaagacagaggagggaatcatatacggcttaat
cctacctttcgccagaactttcgcaactgcttgaccggttctcagcaactgaatgcgttt
ggtaatctttgtacaaccacagataagcatagagtagatatctcgttcttagataatttt
gcatcctccaaatgggaaactattcttcatttcatggtgggcactgaggccaccgctaca
cctacaacgtcagtactttcattattgaagctgggaggcttgatggaaggacccggtaat
agtccccaaaacctcaaaatcaccaacactggtttccagttccttttgcaggacgtcaac
gctcagatttggacgttgttgctccagtatttgaacttgacccaggaattgcatatggac
cctgtagatgtattgaactttatctttgtgttgggttcactagaacttggtaagagttac
ttggtatccagtttgagtgctacgcaggtgagtatgttggcggatttgcgcgattatggg
cttgtttaccaacgaacagactcttctggtagattctatcccaccagacttgctacaacg
ttgacatcagattcagcagccttgaaaacaccttctatggctatagaacaagcacttgga
gcttcagatggaggtgaagaacaacagattgacactccaacgggtaaccagggtactgta
atcatcgagacaaacttcaagttgtacgcatacaccaactctccgcttgagatagctatt
ctcaacctctttgtccatctaaagtctagattcaccaatatggtgtgtgggcaaatcaca
agagagtctattcgtagtgccttgtacaacggcattaccgcagatcagatcatcaagttc
ttggaaactcacgcgcatccccagatgaagttgttggcaaaggagaaattggacaagaag
attgaattcgatacaagccataatatcaacactgctggaggtgctccacaatcaaaagtg
tcaggtgaaggcaatgtagctcagcataagttagaaattcttcctccaacagtagtagat
caaataaagctctggcaattggaattagatagaatccaaacatttgatgggtatcttttc
aaagacttctctaaccaacaggagttcgacaccttgtccaattatgcatcagaggtcggc
gttcttgtttggagtgacaaaatcaaaaagaaattctttgttacagcagaagggatgacg
caggtggccgagtttgccaataggaagttccaaagaaacagacagtaa

DBGET integrated database retrieval system