KEGG   Scheffersomyces stipitis: PICST_30036Help
Entry
PICST_30036       CDS       T01023                                 

Gene name
LAC4
Definition
Beta-galactosidase (Lactase) (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pic  Scheffersomyces stipitis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PICST_30036 (LAC4)
  Lipid metabolism
   00600 Sphingolipid metabolism
    PICST_30036 (LAC4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PICST_30036 (LAC4)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PICST_30036 (LAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 1021 aa AA seqDB search
MIDYTKNSLVKVLSDPQTVHTNRLPTRAYYLPSESTLSLNGDWDFSYFETPQEAPIPGDN
FEDFKKIRVPGHWQLQGYGRPHYTNVVYPFPVTPPNPPSKNPTGVYRHSFEVPEDWSKKD
YEYRLRFEGVDNSYHLFLNGKLIGYNEGSRNAAEFDVSDCIHKTGKNDLVIRVYQWSSSS
YIEDQDQWWLSGIFRDVYLLGFNKKGYIKNFQVATDLDKEYKNAELRINLQLNTTSDVKI
SLHDPTKNLIFEQKFDKLVPSSELKFPVSEPLKWTAESPYLYLLRIEIVDELEAKISCVE
QQIGFRTVEMKKGLICVNGVPILIRGVNRHEHHPKFGRSVPFDFVERDLKLMKAHNINAI
RTAHYPNHPKFYELANQLGFWVLDEADLECHGFVEAVRIPQNKETQISYDETTRQLFKEA
AEFTSNNPLWENAYIDRANQLVHRDCNQPCIIIWSLGNEAFFGRNHAKMAKEIRRNDIQN
RPIHYEGDLNAEVADMFSRMYITPDEVLEYTKQKAKPLILCEYAHAMGNGPGLLRQYQDL
FYEHEILQGGFVWEWANHGLEDVDSKGNVVYKYGGDFGESPHDGVFILDGLTNSVHDPTP
GLVEYKKVIEPVVILIGEEEVSIKNTFDFIDLNEYTAEYTFLEIIGLDRHVLQSGDLDIS
NLQPKQTRKLALPTLESKPEPGSTVIFHIIIKTKKETRGLRRDHIISWAQRKIQQGSSKI
LKQPGATLKCKQEGNSLQIDSEGSKLVFDLVKGRINYWGSSKELFLSDEMDQGSLTFWRP
SINNDATKDAPYWKSFGLDKMQNHVRDVRVQKQNQFQVTIEVDSFVAPPILAWGFEVKQV
YEVLDKKIKLTTSLKPIGHKDEFIPKTIPRLGYQFIISDKLGSNVRWFGRGPGESYSDKK
EGQWFDVHRLPLDKLDYSYDYPQENGNHEDTDWVLLESKEEVKGTQAENGAKTFGFKASD
SWRVDEAQHPSDIVHDRRFIRLDYKQHGVGTEACGPGPLAEYQFRLNGPIEFEFTLDMIT
N
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgattgactatacaaagaattcgctagtaaaagtactttcagatccacagactgttcat
accaacagattaccaacaagggcatactacctcccgtctgaatcgactttgtctttgaat
ggagactgggattttagttatttcgaaactcctcaggaagccccaataccaggagacaat
ttcgaagactttaaaaagattcgagttcctggccattggcaattacaaggatacggaaga
cctcattacaccaacgtcgtctatccattccctgtaacacccccaaatccaccttcgaaa
aatccaactggggtttatcgccattcatttgaagttccagaagattggtcaaaaaaagat
tatgaatacagactccggttcgaaggagtcgacaactcatatcacttatttctcaatggt
aaactcattggatacaacgaaggaagtagaaatgctgctgaattcgatgtatccgactgc
atccacaaaacaggcaagaatgacttggtcattagagtttatcaatggtctagctcatct
tacattgaagatcaggaccaatggtggttaagtggaatatttagagatgtctacttacta
ggattcaataagaagggctatatcaagaactttcaagttgctactgatttggacaaagag
tacaagaatgccgaattgagaattaacttgcaattgaacactacttcagatgtaaagata
tctttgcatgaccccacaaagaatttgatatttgaacagaagtttgacaaattggttcca
tcttctgaactcaaatttccagtttcagagcctttgaaatggacagcggagtcgccttac
ttgtaccttcttcgaattgagattgtcgacgaattagaggcaaagatttcttgtgttgaa
caacagatcgggttcagaacagtagaaatgaagaaaggcttgatctgcgtcaatggagtt
ccaattttgataagaggagttaatagacatgaacaccatccaaagtttggcagatcagtt
ccttttgactttgtagaaagagacttaaaacttatgaaagctcacaatatcaacgccatt
agaactgctcattacccaaatcatcccaagttttatgaattggcaaatcagctaggattt
tgggttttagacgaagccgacttagaatgtcatggattcgtcgaagctgtacgtattcca
cagaataaggagacacaaattctgtacgacgaaaccactcgtcaactattcaaagaagca
gcggaattcacatcaaataacccgttatgggagaatgcttatatagaccgtgcaaatcaa
ttggtgcatagagattgtaatcaaccctgcatcatcatatggtctctaggaaatgaagca
tttttcggacggaatcatgctaaaatggcgaaagaaatcaggagaaatgatattcagaac
agaccaattcattacgaaggagatttgaacgctgaagttgccgacatgtttagtagaatg
tacatcactcctgatgaagttcttgagtatactaagcagaaagcaaaacccttgattcta
tgtgaatatgctcatgcaatgggaaatggacccggacttttaagacaataccaggactta
ttctatgagcatgaaattcttcaaggaggatttgtctgggaatgggcaaaccacggattg
gaagatgttgattccaaaggaaatgtagtatataaatacggcggtgacttcggcgagtct
cctcacgacggtgtttttattttggacggacttacgaattctgtccatgacccaactcct
ggattggtggaatataagaaggtgatcgagcctgtagttattttaattggagaagaagaa
gtttccatcaagaatacttttgatttcatcgacttgaatgagtacacggctgaatacaca
tttctcgaaatcattggattagatagacatgttttgcaatccggagatttagacatctct
aatttgcagcccaaacaaacaagaaaactagcactcccaactttggaatccaaacctgag
cctgggtccactgttatatttcatatcattatcaaaacaaagaaagaaactcgcggttta
cgtcgagaccatattatctcttgggcacagagaaagatacaacagggaagctccaaaatt
ctcaagcaacctggtgcaactttaaaatgcaaacaagaagggaacagtttgcagatcgat
tccgaaggatccaagttggtgtttgatttggttaaagggagaattaattattggggatca
agcaaagaacttttcttgagcgatgaaatggaccaaggaagtttgacattctggagacca
agcatcaataatgatgctaccaaagatgcaccatactggaaatcatttggcttggacaag
atgcaaaaccatgttcgtgatgttagagttcaaaaacaaaaccaatttcaagtaaccatc
gaagtagattcctttgtggctcctcctatattagcctggggatttgaagtgaaacaggtt
tacgaagtgcttgacaaaaagatcaaattaaccacttctttgaagccaattggccacaag
gatgagttcattcccaagacaattcctcgtctaggttatcagttcattatttctgacaaa
ctaggatctaacgtgagatggtttgggcgaggtcctggagaaagctatagtgacaaaaag
gaaggacaatggttcgatgttcatagacttccgcttgacaaattggattacagctacgat
tacccacaagaaaacggaaaccatgaagataccgattgggttcttcttgaatcaaaagaa
gaagtcaaaggcacacaagcagaaaatggagctaagactttcggattcaaggcgtcggat
agctggcgagtagacgaggcacagcatccatctgacatagttcatgatagacggtttatt
cggttagactacaagcaacatggagttggaaccgaggcttgtggtcctggtccattagcc
gaatatcaatttagacttaacggtccaatagagttcgagttcacactagacatgataacg
aactag

DBGET integrated database retrieval system