KEGG   Scheffersomyces stipitis: PICST_30672Help
Entry
PICST_30672       CDS       T01023                                 

Gene name
MDL2
Definition
(RefSeq) ATP-binding transporter
  KO
K01509  adenosinetriphosphatase [EC:3.6.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PICST_30672 (MDL2)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     PICST_30672 (MDL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 AAA AAA_16 ABC_ATPase DEAD AAA_29 ATP-synt_ab
Motif
Other DBs
NCBI-GeneID: 4837690
NCBI-ProteinID: XP_001383758
JGI: 30672
UniProt: A3LRF7
Position
3
AA seq 828 aa AA seqDB search
MKKCRVLQLKSCFFPQTQNPDMSFKYPVPSKPKSHMDKEVKSRLSATSNFPKRSVIYNES
ILKNSVIHPKNFHNFVSIRSFSTGSIISKDIHKDVGDGKSKAELSNSLNAHLELARLKKQ
EIKQEEKVEQIKSKKSFRQNLQTIGRIIRLGKPDLRLFLYALAFILFAVLYPTTAVKLVG
ASIDAYNSHVIDADGDLLIWGYKYSTVFTFMVPFMMVSAVCFWARIWVLKVLGERLVARL
RLRVMKHLLRHDAAFYDQEKHKVGDLISRLSSDAYVVSKSITSNLPDGLKNFLFGIISSY
MMYSINPLLFCVMLLISPPITIGSVWYGEKIRELSTRLQNATAGLTKISEETLNAVKLVK
AFTGEQKELSKYSDQLRQVVKVAKKEALAQSNYSVSIYGLYHTGYLSCIALGVYLILNGS
MTTGDVVAFTMYSELFNSSLYSLTTTYMELMKGAGAGVKLFDLIDHDNEVPAITGEKIPQ
WIGNDIEFKDVVFSYPTRPTDKVFRGCSFKISPSSSTCIVAPSGCGKSTIAALLLRSYNI
DEGEITIGGVNIKDVQVRELRRKVIGIVQQEPVLLSGSILENIVYGLTPQEINDLTMDDI
IEISRQANCHDFIEAFPDGYNTLIGSRGASLSGGQKQRIAIARALIKKPSVLILDEATSA
LDSKSESLINETLKDLTSQGKMTIISIAHRLSTISKSEFVVVLGKNGNVVEQGRFVELFS
NANSELSKLLDESSNLKQEQKLSDQEIEQQDHINHETELLEITQKLGKLESLKAIIDDLP
LELKKELVEQMSNESKENQSELVEQIVEESKKADSDLPNPKLTPDELR
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatgtcgagttttacaattgaagtcttgcttctttccacaaacccagaacccg
gatatgtctttcaaatacccagttcctctgaagccgaagtctcatatggacaaagaagtg
aaaagtcggctttccgctacttcaaactttccaaagcgatcagtaatatacaatgaatcg
attttgaagaatagtgtgatacatcctaagaatttccacaattttgtcagcatacggtcg
ttttcgactggatctatcatttcgaaagatatacataaagatgtaggagatgggaaatcc
aaagcagaattgtccaattcgctcaatgcccatttggaattggcccgattgaaaaagcaa
gagatcaagcaagaagagaaagtggagcaaatcaagagcaaaaagtcatttcgccagaat
ctccagactattggccgaatcatccgattaggtaaaccagatttgaggttattcttgtat
gctttagcattcattttattcgctgtcttgtatccaacaacagctgtgaagttagtagga
gcctccatagatgcttataactcccatgtgatagatgctgatggagatttgctcatctgg
ggatataagtattccacagtgttcaccttcatggtaccgttcatgatggtcagtgcagtg
tgtttctgggccagaatctgggtgttgaaggttttaggagaacgtcttgtagcgagattg
cgtcttcgtgttatgaagcatttgttgcgacatgatgcagctttctacgaccaggagaaa
cataaagtgggagacttgatatctcgtttatcgagtgatgcctatgtagtttccaaatcc
attaccagtaacttgcccgatggattgaagaacttcttgtttggtatcatctcttcttat
atgatgtattcaatcaaccccctcctcttctgtgtgatgttgttgatctctccacctatc
acgataggctctgtatggtatggtgagaaaatcagagaactttctaccagactccagaat
gcaacggctggcctcacaaaaatcagtgaggaaacgcttaatgctgtcaagttggtaaag
gcattcacaggggaacagaaagagttgtccaagtattcagatcaacttcgtcaagtagtc
aaggtagcaaaaaaggaagctcttgctcagtcaaactactcggtttccatatacggattg
taccacactggttacttgtcgtgtatagcattaggagtgtatttgatattgaacgggtcc
atgactactggtgatgtggttgctttcacaatgtatctggagttgttcaacctgtcatta
tacagtctaaccactacctatatggagttgatgaaaggagctggagccggagtcaaactc
ttcgacctaatagaccatgacaacgaggttccggctataaccggggaaaaaattccccaa
tggataggaaatgacatcgagttcaaggacgtggtgttcagttatcctactaggcctact
gataaagtcttcagaggctgtagtttcaagatctctccatcttccagtacttgtatagtt
gctccttctggttgtgggaagtctacgatagctgcgttgctcttaagatcttacaatatc
gatgaaggagaaataactataggaggtgtcaacatcaaggacgtccaagttcgtgaattg
agacgaaaggtcattggcattgttcaacaagagccagtattgttgtctggaagtatcttg
gagaacatcgtctacggtttgactcctcaggaaatcaacgacctcaccatggatgatata
attgagatttctagacaagccaactgtcacgatttcatagaagcttttcccgatggctat
aacacgttaattggatctcgtggagcttctttgtctggaggacagaagcaaagaatcgca
atcgctcgggctttgatcaaaaaaccttcagtattaatattagacgaagccacgtcagct
cttgactctaagctggaaagcttgatcaatgagacattgaaggatctcacatcgcaagga
aagatgacgataatatcgattgcgcatcgtttgtcgacaatttctaagtcggagtttgta
gtggtacttgggaagaacggtaacgtagttgaacagggtagatttgttgagttgttcagc
aatgccaactccgagttgtccaaactattagacgaatcgagcaacttgaagcaggaacaa
aagctttcagaccaagagattgaacagcaagaccatataaaccatgagacagagttgtta
gaaattacccagaaattgggcaagttggaatctttgaaagcgatcatagacgacttgcca
ttagagttgaagaaagaattggtggaacaaatgtccaacgaatctaaagagaatcaaagc
gagctcgttgagcaaatagttgaagaaagtaaaaaggcagatctggacttacccaatccg
aagttgactcctgatgaattaagatga

DBGET integrated database retrieval system