KEGG   Scheffersomyces stipitis: PICST_30874Help
Entry
PICST_30874       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
pic  Scheffersomyces stipitis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PICST_30874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1842 aa AA seqDB search
MDSVTSIRSDLLNVLMAPGKSDGSRARLVDQSKPVTFSDGDEYRINKSFAEIAVLLASEF
DLDEVITAELLFHANNLSFQKGTNLADSARIAFYQRSSYILNILIFLVGSGQVSSVVTGE
AEYELFFRNILGSFSRIYTLLSILNDLIDKQRVTSDINSLEFIKAIGHARAQLFEHHELL
GQLLYSLIEAEPRKYADQAHFAEIADLLNKKVSDEDVFVLHFLPAIFSLVTQTLGSDAEA
DKLHRHITSTLATDYRTVADNDVVDVSKSKLKGVDIVVYFFFLSRFVPWCKQSDERTKKY
DYKDDILRYLEWLINYGAMERLLSYTADTAHPHTTQLFEWSNLYDFRSLLQKSCPRLSPV
KFVYPSAQEVIHASHTKPGLDNVSILFDTTVYKVTPAFSENLLAPLFHQFFTCFINNSAL
ILTSLRDTEEDFVLSYINRKQIENDSDIDAVVTRSKTEANGDAPSKNDKSRSDELDLDEI
ASRSDLERFYLAFAYTYNSRPELCSDFWSSDEITNDIVGFLAWGLSNNTSPLITATFSLL
LGSLASSGDEASARIWEILVKNNTSLKKNDYSKISIDSIVDSLNYYIDALIENFEQDLFD
QIKQQQKRQEFLFSSSSSKQDGDDQSNNKIVIELAEDAVVFISGFVQLISSIVRNLSSSN
ERSNEIKNIAFSRFSPIITGFLRFDNLITGSKLVSVDIQPIGANAPKLIDLPSVLVNEDN
RVVLSNLMLSFLADFVHNGDNLATNYKVWRIVDRWIYHGLLDQTNSNGPTPSQLDSTSLR
QPPSKPKYSSKRNLRINQAFQISLSHLSQVSNFTRLLACLLKPLSNENQAFTPYSLLYPV
DLGYGYRSNNLIGIWPYIEYLLLEVLAKTDDLDSNEDRHKLQGVIMEIIYSSLGEVDWKF
LNDLAPNVIKNITNIDDIFDSLVPNIHMTYQLFVKSHHSMAVMNFLFDEKAWKALFSIIN
IGVDAASSSDDLSILIQNTLSTIDKVLELQDTFINRLLPMLKNKDIVPISNTSAPNGFGT
SMSLALSTPRSVSDNFYFPKAVGTHGTSDFYEIFLFNLKTVAHFGLYVGSSNPVLAESAL
SILDRIRLSHYFIAKNSFSSNDPVLNTNRLLTTFESIDESLKIKYAFIDHFESYETNLEL
KYKILHFLLGNLNQATGKEPTVAHFLLGYDIRGGKLFFHDSDNTNTLLKCLLSCLNLSLD
LISEIDYNNGNNNIIDIGPAKLSSLILEILIKLSRDSISSIITLNHLRESDSLFEKLINY
QPRLDMHTIWCGNTFDGDLQEENYNEFVNSALSTQAFFSFINQRNLILQYLSLEFHHIVS
ITKKEFYTQLLLNNKEFLNGTPKFLSFLDVLNYNFNNFEIHNGEGFNRKYNLPLLIEHVH
DEQTHTVDLSVLNKVYKLVCQSSTFTTREQKISFAQEIMVEGNKISEFVTKYLVSNDLRE
IQLKTLHSWCQLVEILITDDTVGSKNFILEVLQVILPKINDYLESDILFSEELISLSVLL
FDLYDQEILAEKNNEDFALGIQRLIPLFKTCIAGILNSNSTPNLRSDLYVLANKFLIKVI
SSEELVRELSVIIKSVDKKFVDLISNDAIYSEGSSRITSILLLESLFHLASLSKNNFILD
LLVKNNSLLLLLRSVTRTDEMLSICSKSGSGVSLDSLLYELTAFRSTLYLLIRVAQSKAG
ALQLIQGEIFSILKQSNLLKIDPDLGLDLSFDEFQDLKNVRVNLLLDTPLSLNDLADIRN
IRNENSISYFEFLIPIFQLIATVLLSMGPSYKPSIIQARDLMAGVNRLVVGIMKRDIILE
TKKVEPSLYKEDQFSLHGLKELVRLFTLLDSLISYEEKNRYV
NT seq 5529 nt NT seq  +upstreamnt  +downstreamnt
atggacctggtcacctccatcagactggatctactcaatgtgcttatggctccaggcaaa
agcgacggatccagggctcggttggtcgaccagctgaagccagtgaccttttctgatggc
gatgagtatcgcatcaacaagctgttcgcggagattgcagtcttgcttgcgtcggagttt
gacttggacgaagtcatcacggccgagttgcttttccacgccaacaacttgagcttccag
aagggtaccaatctcgccgactccgccaggatcgcgttctaccagcgactgctgtacatt
ttaaacatcttgatctttctcgtcgggctgggccaggtgctgtcagttgtaacgggggaa
gctgagtacgagctcttcttccgtaatatcctcgggtcattttcgaggatctatacgctt
ctcagcatccttaacgatctcatcgacaaacagcgagtcactagcgatataaatagcctt
gaatttatcaaggcgataggccacgccagagcacagttgtttgagcaccacgaactcttg
ggccagttgttgtacagcttgatagaagcagaacctcgtaaatacgccgaccaggcgcat
tttgcagaaatagctgatttgctcaataaaaaagtctcagacgaggacgtatttgtgctc
cactttttgcctgccatattcagtcttgtaacgcagactttgggctccgatgccgaagcg
gacaagcttcacagacacatcacgtctacactcgcgaccgactaccggaccgtggcagat
aacgatgtagtggacgtgtccaagtcgaaactcaaaggtgtggatatcgtagtgtatttc
ttcttcttatccaggttcgtcccctggtgcaagcagctggacgaacgtactaaaaaatac
gactacaaggacgacatacttcgctacttggaatggctcatcaactacggggccatggag
agacttttgtcgtacacagcagacacggcacatccgcataccacacaactttttgaatgg
agcaacctctacgactttcggtcacttctccagaagtcgtgtcctcgtcttagcccggtg
aagtttgtgtatccgtcagctcaggaggtaatccacgcatcgcacaccaagccaggattg
gacaacgtctccatacttttcgatactactgtctacaaggtgacaccggccttcagcgag
aacttgttggcgccgcttttccaccagttcttcacgtgcttcatcaacaattctgcgttg
atattgacactgttgcgtgacacagaagaggactttgtgttgtcatacatcaatagaaag
cagatcgagaacgactcggacatcgacgccgtagtaactagaagcaagacagaagccaac
ggagatgcgccatccaagaacgataaatcgaggtctgacgagcttgatctcgacgagata
gcctcacggtcagacttagaacgtttctacttggccttcgcctacacatacaactcgcgg
ccagagctctgttcggacttctggtcatcagacgaaataacgaacgacatcgtaggcttc
ctcgcgtgggggttgagcaacaatacgtctccgctcatcacggctaccttcagcttgttg
ctcggttcgttggcgtctagcggtgacgaagcttctgcccgtatctgggagatcttggtc
aagaacaatacttccttgaagaagaatgactactccaagatttccatagactccatcgtc
gactctttgaactattacattgacgctctcatagaaaacttcgagcaggacttatttgac
cagatcaagcaacagcagaagagacaagagtttctcttttcgagcagctccagcaagcag
gatggagacgaccaaagcaacaataagattgtcatagaattggccgaggatgctgttgtc
ttcatttcaggatttgttcagttgatctcgtccatcgtaagaaatctttcgtcgtcgaat
gagcgttccaacgaaatcaaaaatattgccttctccagattctcgcccatcatcacgggg
tttttgagatttgacaatttgatcacgggctccaagttggtatcagttgatattcagcct
attggagccaatgcacccaagttgatcgatttgccaagcgttttggtcaatgaagacaac
agagtcgttttgtcgaacttgatgttgagcttcttggctgacttcgttcataacggtgac
aatctagctacaaactacaaggtgtggcgaattgttgaccgctggatataccacggctta
ttagaccagacaaacagcaatggcccaactccgtctcaattagatagcacgtcacttaga
cagccgccgtccaaacccaagtattccagcaagcgcaacttgagaatcaatcaggctttc
caaattagcttgagccacctttcccaggtctctaatttcaccagattgttggcatgtcta
ttgaagccgcttagcaacgagaaccaagctttcacgccgtactcgctcttgtaccctgta
gatttgggttatggctatagaagcaacaacttaataggcatttggccgtacatcgaatac
ctcttgttggaggtattggcaaagaccgacgacttggatctgaatgaagacagacataag
ttgcaaggcgtcatcatggagatcatctattcatctttgggagaagtcgattggaagttt
ttgaacgaccttgctcctaatgtcatcaaaaatatcaccaacattgatgacatctttgac
tctttggtgccaaacattcatatgacgtaccagttgtttgtaaagctgcatcattcgatg
gccgtgatgaacttcttgtttgacgagaaggcatggaaagcattattcagtatcatcaat
atcggtgtagatgctgctagttcaagcgatgacttgtcaattttgattcaaaacactttg
tctactattgacaaggttttggaattgcaggacacctttatcaatagattgcttccaatg
ttgaagaacaaggatattgttcctatatctaatactagcgctcccaatgggtttggtacc
agcatgagcttagcacttagcactccgagatcagtgtccgacaacttttatttccccaaa
gctgtaggtacacacggaacgtctgatttctacgagatatttttattcaacttgaagact
gtagcccattttggactttatgttggttcgtccaatccagttcttgcagagtcagctttg
agcatcttggataggattcgcttgtctcactactttattgccaagaatctgttcctgtcc
aatgacccagttttgaacacgaacagattattgacaacttttgaaagtatcgatgaatcg
ctcaagatcaagtatgcgttcattgatcactttgagagttacgaaaccaacttggagttg
aagtataagattctccatttcttgctagggaacttgaatcaagccactggaaaggagcct
acagtggcacatttcctcttgggttatgatatcagaggtggaaagctatttttccacgat
tccgataatacaaatacactcttgaaatgtttgttgagctgcttgaacttgagtttagat
ttgatttcggaaattgactacaacaacggaaacaacaatatcatcgacattggtccggcc
aagctctcgtctttgattttggaaattttgatcaagcttagtagagattcgatttcctct
attattactttgaatcatttaagagaatcagacagtttgtttgaaaagttaatcaactat
caaccccgtcttgatatgcacactatctggtgtggaaacacatttgatggtgatcttcaa
gaggaaaactataatgagtttgtgaatagcgccttgagtacccaggctttcttttcattc
atcaaccaaagaaacttgattttgcagtacttgtcgcttgaatttcatcatatcgtttcc
atcaccaagaaggagttctatacgcaattgctcttgaacaacaaggaatttttgaatggt
actccaaaattcttatctttcttggatgtcttgaactataatttcaacaactttgaaatt
cacaacggcgaaggattcaacagaaagtacaacttgcccttattgattgaacatgtacac
gacgagcaaacccacacagttgatttgtcagtgttgaacaaggtgtacaagctagtatgc
caatcgtcaacgttcacgactagagaacagaagatttcatttgcgcaagaaataatggtg
gaaggaaacaaaataagcgagtttgtcacgaagtatttagtttccaacgacttgagagaa
attcaattgaagacattgcattcgtggtgtcaattggttgagatattgatcactgatgat
acggttggatccaaaaacttcatccttgaggttctacaggtaattttgccaaagattaac
gactacttagagtcagacatcttgttctctgaagagcttatctcgttgagtgtgttgttg
tttgacttgtatgaccaagaaatattggccgagaagaacaacgaggattttgcattggga
atccagagattgatccccttgttcaagacatgcatagctggtatcttgaattctaattca
actccaaacttgagatctgatttgtatgtcttggccaataagtttttgatcaaggtgatc
agcagcgaagagctcgttagagagttgtctgttattatcaaatctgtggacaagaagttt
gtcgatctcatttccaacgacgcaatatattctgaagggtcttcccgaatcacttcgatt
ttgttattggagtcgttattccacttggcgtcgttgtcaaagaacaatttcattctagac
ttgttggtgaagaacaactcgttgttgttgttgcttcgttcagttaccaggaccgatgag
atgttgctgatttgctcaaagagtggatctggtgtaagtttagattcgttgttgtacgag
ttgactgcattccgttccacactctatcttcttatcagagttgcccaatcaaaagctggt
gcattgcagttaatacagggcgaaatcttttccattctcaaacaatccaacttgttgaag
atcgacccagacttgggattggacttgctgtttgacgaattccaagaccttaagaacgtc
agggtcaacttactcttggacacaccgttgtcgttgaatgatttggccgatattaggaac
atcagaaacgagaacagcatctcttactttgagttcttgattccgatattccaattgata
gctaccgtccttttgtcaatgggccccagctataagcctagcatcattcaagccagagat
ttgatggctggcgtgaacagactagttgtaggcataatgaagagagacatcatattggag
actaagaaggttgaacctctgttgtacaaagaggaccagttttcactacatgggttgaag
gagttggtgaggttgtttaccttgttggactcgttgatctcgtacgaagaaaagaacaga
tatgtttag

DBGET integrated database retrieval system