KEGG   Scheffersomyces stipitis: PICST_31592Help
Entry
PICST_31592       CDS       T01023                                 

Gene name
DFG10
Definition
possible roles in filamentous growth, cell polarity, and cellular elongation (EC:1.3.99.5)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PICST_31592 (DFG10)
    1.3.1.94  polyprenol reductase
     PICST_31592 (DFG10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 305 aa AA seqDB search
MSSSNWQRWGQLPDVSLYHIVLGGYVFMTANVLLVKFIKPLNSLLLYGKNRAQTTGDSSE
NAQNSKSILSKLIDDIFNLTVPKAWFSHYYVSFFVYCTLIQIVDIYKAAPVTELASNDVL
YKSNKLIHIMLWIQSTRRTLECFTFTKFAANSKINFSHYIVGMAFYALVSLNSYVSLKEL
HPIAFSEVWKLITTADVALFAIFLAASFDQFRNHYHLATLVKYTIPYKFKLVASPHYTDE
IIIYSVVAAISCKESLSSFASINYLSCLIFTVVNLSVTSVDTYKYYQQKFGDKFKLQWAI
LPGIL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagttctagcaattggcaacgctggggtcaactccctgatgtgctgttgtatcatatt
gttttgggtggatatgttttcatgactgcgaatgtcttgttggtcaaattcatcaagcca
ttgaattcacttcttctctatgggaagaacagagctcagactactggagacagcagcgaa
aatgcccaaaactccaaaagtatactttcaaagcttattgatgatatttttaatttgacg
gtgccaaaagcatggttttcccactattatgtgctgttctttgtctattgcactctcatt
caaattgtggacatctacaaagctgctccagtcacagaattggccagtaatgatgtgttg
tacaaatccaacaaactaattcatataatgctctggattcagagtacgagacgtacactt
gaatgcttcaccttcaccaagtttgcagccaattcaaagatcaacttctctcattacatc
gtagggatggctttttatgcacttgtatcgctcaattcctacgtcagtttgaaggagttg
catcctatcgccttcagtgaagtttggaaattaataaccacggcagatgtcgctttattt
gccattttccttgctgcgctgtttgatcagttcagaaaccattaccatttggctactctc
gtgaaatacactataccgtataaatttaagctagttgcctctccccattacaccgacgaa
attatcatatattcagttgtggccgcaattagctgcaaagaactgctttcgagcttcgct
agcatcaactacttgctgtgtttgattttcacagtagtcaatcttagtgtcacctccgtc
gacacatacaagtactaccagcagaaatttggagataagttcaagctccaatgggctatt
cttccaggaatattgtag

DBGET integrated database retrieval system