KEGG   Scheffersomyces stipitis: PICST_32069Help
Entry
PICST_32069       CDS       T01023                                 

Gene name
HEX1
Definition
Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase (EC:3.2.1.96)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pic  Scheffersomyces stipitis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PICST_32069 (HEX1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    PICST_32069 (HEX1)
   00603 Glycosphingolipid biosynthesis - globo series
    PICST_32069 (HEX1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    PICST_32069 (HEX1)
   00511 Other glycan degradation
    PICST_32069 (HEX1)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PICST_32069 (HEX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 614 aa AA seqDB search
MKLTSLVVTIAPLLALTQAVKVNPLPAPRSIDWLDENPISVNLDKLNLEIGAENSIISEA
FYRTVSTLRKLKWYPAATEAPISSFVPFPTAEAAVDAKKKKRDSQRTFDLSGLSVVEVTV
NDYAADLQMGVNETYTLSVSPSSIIIESETVWGVLHAFTTLQQLIIYDNSKFVIEGSVNI
WDAPLYQHRGVMVDTGRNYLSIDSILDQIDMMALSKLNSLHIHLDDAQSWPLLLNSYPEM
IMDAYSEREIYTIQDLQHIIKYAKNRGVRVIPEIDLPGHARAGWRQINPDLVACGDSWWS
NDVWASHTAVEPPPGQLDIMNDEVYEVIADVYNELSEIFTDNVFHVGADEIQTGCYNMST
LIQNWFKEDPSRSWNDLSQYYVDKAYPIFMNKTNRRLMMWEDILLTPEGAHTLPTDVILQ
SWNNDLVNIQNLTSRGYDVIVSSSSHFYLDCGFGGWVSNDPRYIDDYSNDVFNTGLGGSW
CAPYKTWQRIYDYDFTANLTDAQAEHVIGAEVALWSEQVDSTVLTQKIWPRAAALAESTW
SGNRNSEGYLRTNELTQRILNFREYLVALGFGASPLVPKYCLLNPHACDLYQNQTVLEQY
GTHNDKNSTIAVLN
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgactagcttggtggttactatcgctccattgttggcattgacccaggcggtt
aaagtaaatccactcccagctcctagactgatcgactggctcgatgaaaacccaatttct
gtgaatttggataagttgaacttggaaattggcgccgaaaactcgattatttcagaagcc
ttctacagaaccgtttcaacattgagaaagttgaaatggtatccagccgctactgaagct
cctatctccagctttgttccatttcctactgctgaagctgctgttgacgccaaaaagaaa
aaaagagacagccagcgtacctttgacttgtctggcttgagcgttgtggaagtcacagtt
aacgattatgccgctgaccttcaaatgggagtcaatgagacatataccttgtccgtttcc
ccctccagtattataattgaatctgaaaccgtttggggggttctccacgctttcactacc
ttgcaacaattgatcatctacgacaatagcaagttcgtcattgagggatcagtaaacata
tgggacgcccctctttaccaacatcgtggtgtgatggttgatactggtcgtaattacttg
agcattgactccatcttggatcaaatcgacatgatggctctttccaagttgaactctttg
cacattcacctagacgatgctcagagttggccattgttattgaactcgtacccagaaatg
atcatggatgcctacagtgaacgtgaaatctacactatccaagaccttcaacacatcatc
aagtatgcaaagaacagaggtgtgagagttataccagaaatcgaccttccaggacatgct
cgcgctggttggagacagatcaaccctgatttggttgcttgtggtgactcatggtggtct
aacgacgtctgggcttcccatactgctgtagagccacctccaggtcagttggacatcatg
aatgatgaagtatacgaagtcattgctgatgtttataatgaattgagtgagattttcact
gataatgtatttcacgttggcgccgatgagatccaaactggatgttacaacatgtcgacc
ttgattcaaaactggttcaaggaagatccttcaagatcctggaatgacttaagtcagtac
tatgttgacaaggcatacccaatcttcatgaacaagactaacagacgtttgatgatgtgg
gaagatatactcttgactccagaaggtgcccacactttgcctaccgatgttattttgcaa
tcttggaacaacgacttggttaacattcaaaacttgacttctcgtggatacgacgtcatt
gtttcgtcgtcttcgcacttctacttggactgtggttttggtggatgggtttccaacgat
ccaagatacattgacgactactcgaacgatgtgttcaacaccggtttaggaggttcttgg
tgtgctccttacaagacctggcaaagaatctacgactacgattttactgccaacttgaca
gatgctcaggctgaacacgttattggtgccgaagtggccttgtggtccgagcaagtcgac
tctactgttttaacccaaaagatctggccaagagctgctgcattggctgaatccacttgg
tctggtaaccgtaactctgaaggatacttgagaaccaacgagttgactcaaagaatcttg
aacttcagagaatatttggttgctcttggtttcggtgcttcacctcttgtgccaaagtac
tgtttgcttaaccctcatgcttgtgatttgtaccaaaatcaaactgttcttgagcagtat
ggtacacacaacgataagaactccactattgctgttcttaactga

DBGET integrated database retrieval system