KEGG   Scheffersomyces stipitis: PICST_32361Help
Entry
PICST_32361       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
pic  Scheffersomyces stipitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 565 aa AA seqDB search
MSTSRKTVPGGKSVPNAAGTSNGSVSSNGHGKNGTSELDYERESQHRLRPQDNYSTIAAC
SHLKSVLESSARETALITYRQAVNISRPIDNDLIYTAKKDGSVVSHHRLLVRKSSSLRCT
DCSLNNFHHNFTCLQCPHVGCFNDVHNHAYTHYKLTQHVFAIDSHSGLLYCFPCGTYVNH
PALDKVRQEVLLSATDYSDLIKSEVDEEFDYSDVDAHYSDPSRLGVDGLKGFVNLGATCF
MSSILQTFIHNPIIKNHFFNNDLHYFNCEKSMAQGSTLDENNACITCSIDNIFQLFYTSN
SIEGFGMTNLLTTAWYKKKSLAGFQEQDAHEFWQFILNEFHSDYERIRSNTGLSPMSTSD
CNCITHSTFSGELQSSIRCLSCESVTKTIDPMVDLSLEINHLKSNHPGSQIDLYDCLDLF
TSDEKLDVMYTCQSCGDKTKAIKSLSVKSLPPVLSIQLKRFKHNSLNDTSSKIETPIKIP
LYLNMTRYSIGHDPHDSEQIDEDKIFELFALVCHIGSVNTGHYIVLTKDGNGQWFKFDDS
VVSMVSQEEVTNTNAYLVFYITHKI
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatccagaaaaaccgttcctggaggaaagtccgtgccgaatgccgctggaacc
tcgaatggaagtgtttcttccaacggccatggtaaaaatggtacttctgaattagactat
gaaagggaatcccagcataggttgcgaccacaagacaactactccaccatcgcagcctgc
tcccacctcaagtccgtgttagaatcatcagcccgagagacggccctcatcacatacaga
caagctgtcaacatctctcggccaatcgataatgaccttatctacaccgcgaagaaggat
ggctctgtagtgtcgcaccatcgtttgttagtacgaaaatcctcatccttgcggtgcaca
gactgttcgctcaacaacttccaccacaattttacctgtttgcagtgcccgcatgtgggc
tgtttcaatgacgtccacaaccatgcttacacccactataagctcacccaacatgtcttc
gctatcgacagccactcgggcttgctttactgttttccgtgcggaacctatgtcaaccat
cctgctctagataaagtcagacaggaggtgttgttgagtgctacagactacagcgatcta
attaaaagcgaggtagatgaagaatttgattatagtgatgtagatgctcactactcagac
cccagccgcttgggcgtagacgggttgaagggctttgtcaacttgggtgccacttgtttc
atgagttccatcctccagaccttcatccacaaccccatcatcaaaaaccatttttttaac
aacgacttgcattacttcaactgcgaaaagagcatggcacagggttcgactctcgacgaa
aataacgcatgcataacatgtagcatcgataacatatttcagctcttctacacctctaac
agcattgaaggctttggaatgacgaacctcttgaccacagcgtggtacaagaaaaagtcg
ttggccggattccaagaacaagatgcccacgagttctggcagtttatcttgaacgagttc
cactcagactacgaaaggatcagatccaacactggtttaagtccaatgtcaacttcagac
tgcaattgcattacacactctacattctcaggagaactacaaagctctataagatgcctc
tcgtgcgaatctgtgaccaagactatcgacccgatggtagacttgtcgctcgaaatcaat
cacttgaagctgaaccatcctggaagccagatagatttgtacgactgcctcgacctcttc
accagcgatgagaagttagatgttatgtacacctgtcaatcgtgtggtgacaagaccaag
gctatcaagtcgttgagtgtcaagtcgcttccgcctgttctatccatccagttgaagcga
ttcaagcataattcgttgaacgacacttcgtccaaaatcgaaactcctataaagattcct
ctctatttaaacatgactaggtattctataggtcatgatccccacgattcagagcaaatt
gatgaagacaaaatcttcgagctcttcgccttggtgtgccacatcggctcggtgaatacg
ggccactacatagtactcaccaaagatggcaatggccagtggttcaaattcgatgacagc
gttgtctcgatggtttcgcaagaggaggtaaccaatacaaacgcatacttggtgttctac
atcacccacaagatctag

DBGET integrated database retrieval system