KEGG   Scheffersomyces stipitis: PICST_32515Help
Entry
PICST_32515       CDS       T01023                                 

Gene name
SPB2
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pic  Scheffersomyces stipitis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pic00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 440 aa AA seqDB search
MKCSHIVSAPIFLSVAAAVLQPVAWKSDELINDSIDGSSPSLKEMWDDLWPFQGINTFAH
LDHHKCLLEPGNTYDVALIGVPFDTAVSYRPGARFGPRAIRAASQRQTSLRGYNQRANFN
PYASWAKIVDCGDLPITPMDNSIAFTQMTKGFEELLLRRSSNSSSELPPRYVALGGDHSV
LLPHLRALHEVYGRINVIHFDAHLDTWAPDKYPSFWHSDQSEINHGSMLWKAHHEGLTSH
HNVHAGLRTKLSGLEDYEDDDSQHFIRIDADDIWLKGPQWVVQKILDTVPDDSPTYISVD
VDVLDPGFTSGTGTQEPGGWLPRELLHVLRSIEGLTVVGGDVVEVSPAFDTAEITSTNGA
QIAFEIITSMVKKGPIDPAIVKKNKKELVKITHVNELEQEKKDFIDLEKAKKTIEQKLKE
LDELKSELSSQLLELREIPF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgttcacatatcgtcagcgcgcccattttcttatcagtagctgcggctgtgttg
caacctgttgcatggaaatcagatgaattgataaatgactcgatcgatggctcatcacct
tctttgaaagaaatgtgggatgatttgtggcctttccaaggtatcaacacatttgcccat
cttgatcaccataaatgtttgcttgaaccaggaaatacctacgacgtggctcttatcgga
gtaccttttgacactgcagtctcctatagaccaggggctaggtttggtcccagagctatc
agagcagcctctcagagacagacatcgttgagaggctacaaccagagagccaatttcaac
ccctatgcttcttgggctaaaattgtagactgtggagatcttccaataacccctatggat
aactctattgcttttacccagatgacaaaaggatttgaagagttactattgagaagatca
agtaactcatcgagtgagctacccccaagatacgttgcgttggggggagatcattcagtt
ttgcttccgcatttgagggctttgcatgaagtttatggacgtatcaatgtcattcatttc
gacgcccatttggatacttgggctccagacaagtacccttctttctggcactcagaccaa
tctgaaataaatcacggttctatgctttggaaagctcaccacgaagggttgacgtctcat
cacaatgtgcatgctggcttgagaacaaagttgtctggcttggaagattacgaagacgat
gattctcaacattttatcagaatagatgcggacgacatctggttaaaaggtccacagtgg
gtggtacagaaaatcttggacaccgtgcctgatgatagtcctacttacatttctgttgac
gttgatgttctcgatcctggtttcaccagtggaacgggaacccaagaaccaggtggatgg
ttgcctagagagctcctccatgttctcagaagcatagaagggttgactgtggtcggaggt
gatgttgttgaagtgtctcctgctttcgataccgccgaaattacatctacaaatggtgcc
cagattgccttcgaaataatcaccagtatggtcaagaagggtcctattgaccctgcaatt
gttaagaagaacaaaaaggaattggtcaagatcactcatgtaaatgaacttgaacaagaa
aagaaagattttattgaccttgaaaaggctaagaaaacaatagaacagaagttaaaagag
ttagacgaactaaagtcggaactttcgtctcagcttctagaattgagagaaataccattt
tag

DBGET integrated database retrieval system