KEGG   Scheffersomyces stipitis: PICST_32526Help
Entry
PICST_32526       CDS       T01023                                 

Gene name
NAG5
Definition
(RefSeq) hexokinase I (EC:2.7.1.1)
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PICST_32526 (NAG5)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_32526 (NAG5)
   00051 Fructose and mannose metabolism
    PICST_32526 (NAG5)
   00052 Galactose metabolism
    PICST_32526 (NAG5)
   00500 Starch and sucrose metabolism
    PICST_32526 (NAG5)
   00520 Amino sugar and nucleotide sugar metabolism
    PICST_32526 (NAG5)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    PICST_32526 (NAG5)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PICST_32526 (NAG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 550 aa AA seqDB search
MAMIHNSSKVASPTEESIILPMKGLHGDVTISPTPILINQSEESDFIDELSSSTSTSSEP
SPNSSISTDSSCLLSSVVNDFVYDLTSQNFLEQTEFLVADLNESLSRNSKITMLPNYNIS
PTGQESGEFLVIDLGGSTLRIAVIKIDQASDSDDEDRSKRIHILMEKNWTIDNSFKTLDL
NFFKFIGSKIHEILCHQDLIDIRNNIKTGITWSFPLKTTSYNNGKIVHVSKGYTIHPEIY
NQDLKSILESVLLNEFDLHIDVKSILNDSLAVYSAGAFIDKYTKLALVLGTGFNMCCSLS
TSDKMHSDKTLESCDKILFNTELSLFGEHLIKSIATKYDSLIDERFKTFDFHFKPFMSTD
PNTHSIFQPNELMTSGRYLPELTRLVLVDLVEAKEIFVNISQKEELLSSAYDGFSGELMC
FINESTNVDAITEKLCAQYGWSASEVTIGDVLTLKKIVQSIVERAAFIVSVSIVSFIKLL
QQHNDDHFDSSIINIGYVGSVLKHFNVYRDLVKQYVNDNDDIKRLGVQVDFKLIENSSII
GAAIGAAYYS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggctatgatccacaactcttccaaagtcgcatcaccaacagaagaaagcataatactt
cctatgaagggccttcatggagatgtcactataagtccaacacccattctcataaaccag
agcgaggaaagtgacttcatagacgagttgctgtcttctacttctacttccagcgaacct
tcgcccaactcatccatttccactgatagctcgtgtcttttatcttccgtagtaaacgat
tttgtttatgatctcaccagtcagaacttcctcgaacagacggagtttcttgtcgccgac
ttgaatgagtcgttatctagaaactccaagataaccatgttgcccaactacaatatttct
ccaacaggacaggagtcaggtgagtttttggtcattgacttgggaggctccaccttgaga
atcgctgttatcaagatagaccaagcgtcggattcagacgacgaagacagatcaaaaaga
atacacatcttgatggagaagaactggactatcgataacagcttcaagactctcgatctt
aacttcttcaagttcataggctccaagatccacgagatattgtgccatcaggatttgatt
gatatccgcaacaatataaagactgggatcacctggtcgttccctttgaagaccacatcg
tacaataacggtaagatcgtccatgtctctaagggctacaccattcatccagaaatctac
aaccaggacttgaagtccattttagaatcagttttactaaacgagtttgatttacacatt
gacgtcaaaagcattttgaacgattccttggccgtgtactcggcaggtgccttcattgat
aagtataccaagttggcacttgttttgggaacgggattcaacatgtgctgctcattatct
acatcggacaagatgcattctgacaagacgttggaaagctgcgacaagatcttattcaac
actgaactcagtttgtttggtgaacatttgattaagagcatagctaccaaatatgattcg
ttgattgacgagagattcaaaacctttgactttcatttcaagccattcatgtcaactgat
cctaatacccattccattttccaacctaacgagttgatgacaagtggtagatacttgcca
gagttgactcgtttggtgttggtagatttagttgaagctaaagaaatctttgtcaacata
agccaaaaggaggaacttttatcttcggcctatgatggcttcagtggtgagttgatgtgc
ttcatcaacgaatcgacaaacgttgacgccattaccgaaaaattgtgtgctcaatatggt
tggtctgcttctgaagtcaccatcggagatgttttgacgttgaagaagattgttcaaagt
attgttgaaagagcagccttcattgtttccgtctcgattgtgtccttcattaagttgctc
caacagcacaatgatgatcactttgactcatccatcatcaacattggatatgttggctca
gtgttgaagcatttcaatgtctacagagacttggttaaacaatatgttaacgataatgac
gatattaaaaggttaggagtccaggttgattttaagttgattgagaatagttcaatcatt
ggtgctgctatcggtgcagcatactattcataa

DBGET integrated database retrieval system