KEGG   Scheffersomyces stipitis: PICST_32526Help
Entry
PICST_32526       CDS       T01023                                 

Gene name
NAG5
Definition
hexokinase I (EC:2.7.1.1)
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PICST_32526 (NAG5)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_32526 (NAG5)
   00051 Fructose and mannose metabolism
    PICST_32526 (NAG5)
   00052 Galactose metabolism
    PICST_32526 (NAG5)
   00500 Starch and sucrose metabolism
    PICST_32526 (NAG5)
   00520 Amino sugar and nucleotide sugar metabolism
    PICST_32526 (NAG5)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    PICST_32526 (NAG5)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PICST_32526 (NAG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 550 aa AA seqDB search
MAMIHNSSKVASPTEESIILPMKGLHGDVTISPTPILINQSEESDFIDELSSSTSTSSEP
SPNSSISTDSSCLLSSVVNDFVYDLTSQNFLEQTEFLVADLNESLSRNSKITMLPNYNIS
PTGQESGEFLVIDLGGSTLRIAVIKIDQASDSDDEDRSKRIHILMEKNWTIDNSFKTLDL
NFFKFIGSKIHEILCHQDLIDIRNNIKTGITWSFPLKTTSYNNGKIVHVSKGYTIHPEIY
NQDLKSILESVLLNEFDLHIDVKSILNDSLAVYSAGAFIDKYTKLALVLGTGFNMCCSLS
TSDKMHSDKTLESCDKILFNTELSLFGEHLIKSIATKYDSLIDERFKTFDFHFKPFMSTD
PNTHSIFQPNELMTSGRYLPELTRLVLVDLVEAKEIFVNISQKEELLSSAYDGFSGELMC
FINESTNVDAITEKLCAQYGWSASEVTIGDVLTLKKIVQSIVERAAFIVSVSIVSFIKLL
QQHNDDHFDSSIINIGYVGSVLKHFNVYRDLVKQYVNDNDDIKRLGVQVDFKLIENSSII
GAAIGAAYYS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggctatgatccacaactcttccaaagtcgcatcaccaacagaagaaagcataatactt
cctatgaagggccttcatggagatgtcactataagtccaacacccattctcataaaccag
agcgaggaaagtgacttcatagacgagttgctgtcttctacttctacttccagcgaacct
tcgcccaactcatccatttccactgatagctcgtgtcttttatcttccgtagtaaacgat
tttgtttatgatctcaccagtcagaacttcctcgaacagacggagtttcttgtcgccgac
ttgaatgagtcgttatctagaaactccaagataaccatgttgcccaactacaatatttct
ccaacaggacaggagtcaggtgagtttttggtcattgacttgggaggctccaccttgaga
atcgctgttatcaagatagaccaagcgtcggattcagacgacgaagacagatcaaaaaga
atacacatcttgatggagaagaactggactatcgataacagcttcaagactctcgatctt
aacttcttcaagttcataggctccaagatccacgagatattgtgccatcaggatttgatt
gatatccgcaacaatataaagactgggatcacctggtcgttccctttgaagaccacatcg
tacaataacggtaagatcgtccatgtctctaagggctacaccattcatccagaaatctac
aaccaggacttgaagtccattttagaatcagttttactaaacgagtttgatttacacatt
gacgtcaaaagcattttgaacgattccttggccgtgtactcggcaggtgccttcattgat
aagtataccaagttggcacttgttttgggaacgggattcaacatgtgctgctcattatct
acatcggacaagatgcattctgacaagacgttggaaagctgcgacaagatcttattcaac
actgaactcagtttgtttggtgaacatttgattaagagcatagctaccaaatatgattcg
ttgattgacgagagattcaaaacctttgactttcatttcaagccattcatgtcaactgat
cctaatacccattccattttccaacctaacgagttgatgacaagtggtagatacttgcca
gagttgactcgtttggtgttggtagatttagttgaagctaaagaaatctttgtcaacata
agccaaaaggaggaacttttatcttcggcctatgatggcttcagtggtgagttgatgtgc
ttcatcaacgaatcgacaaacgttgacgccattaccgaaaaattgtgtgctcaatatggt
tggtctgcttctgaagtcaccatcggagatgttttgacgttgaagaagattgttcaaagt
attgttgaaagagcagccttcattgtttccgtctcgattgtgtccttcattaagttgctc
caacagcacaatgatgatcactttgactcatccatcatcaacattggatatgttggctca
gtgttgaagcatttcaatgtctacagagacttggttaaacaatatgttaacgataatgac
gatattaaaaggttaggagtccaggttgattttaagttgattgagaatagttcaatcatt
ggtgctgctatcggtgcagcatactattcataa

DBGET integrated database retrieval system